PDB entry 2bjf

View 2bjf on RCSB PDB site
Description: crystal structure of conjugated bile acid hydrolase from clostridium perfringens in complex with reaction products taurine and deoxycholate
Class: hydrolase
Keywords: amidohydrolase, ntn-hydrolase, bile acids, hydrolase, bsh
Deposited on 2005-02-02, released 2005-03-03
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.67 Å
R-factor: 0.183
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: choloylglycine hydrolase
    Species: Clostridium perfringens [TaxId:1502]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2bjfa_
  • Heterogens: DXC, TAU, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bjfA (A:)
    mctglaletkdglhlfgrnmdieysfnqsiifiprnfkcvnksnkkelttkyavlgmgti
    fddyptfadgmnekglgcaglnfpvyvsyskediegktnipvynfllwvlanfssveevk
    ealknanivdipisenipnttlhwmisditgksivveqtkeklnvfdnnigvltnsptfd
    whvanlnqyvglrynqvpefklgdqsltalgqgtglvglpgdftpasrfirvaflrdami
    kndkdsidlieffhilnnvamvrgstrtveeksdltqytscmclekgiyyyntyennqin
    aidmnkenldgneiktykynktlsinhvn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bjfA (A:)
    ctglaletkdglhlfgrnmdieysfnqsiifiprnfkcvnksnkkelttkyavlgmgtif
    ddyptfadgmnekglgcaglnfpvyvsyskediegktnipvynfllwvlanfssveevke
    alknanivdipisenipnttlhwmisditgksivveqtkeklnvfdnnigvltnsptfdw
    hvanlnqyvglrynqvpefklgdqsltalgqgtglvglpgdftpasrfirvaflrdamik
    ndkdsidlieffhilnnvamvrgstrtveeksdltqytscmclekgiyyyntyennqina
    idmnkenldgneiktykynktlsinhvn