PDB entry 2bhn

View 2bhn on RCSB PDB site
Description: xpf from aeropyrum pernix
Class: hydrolase
Keywords: structure specific endonuclease, nucleotide excision repair, hydrolase
Deposited on 2005-01-14, released 2005-02-23
The last revision prior to the SCOP 1.73 freeze date was dated 2005-06-15, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.22099
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: xpf endonuclease
    Species: Aeropyrum pernix
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2bhna1, d2bhna2
  • Chain 'B':
    Compound: xpf endonuclease
    Species: Aeropyrum pernix
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2bhnb1, d2bhnb2
  • Chain 'C':
    Compound: xpf endonuclease
    Species: Aeropyrum pernix
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2bhnc1, d2bhnc2
  • Chain 'D':
    Compound: xpf endonuclease
    Species: Aeropyrum pernix
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2bhnd1, d2bhnd2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bhnA (A:)
    rprvyvdvreerspvpsileslgvqvipkqlpmgdylvsdsiiverktssdfakslfdgr
    lfeqasrlaehyetvfiivegppvprryrgrerslyaamaalqldygirlmntmdpkgta
    lvieslarlstreggqrivihkkprlsdvrewqlyilqsfpgigrrtaerilerfgsler
    fftaskaeiskvegigekraeeikkilmtpykrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bhnA (A:)
    prvyvdvreerspvpsileslgvqvipkqlpmgdylvsdsiiverktssdfakslfdgrl
    feqasrlaehyetvfiivegppvprryrgrerslyaamaalqldygirlmntmdpkgtal
    vieslarlstreggqrivihkkprlsdvrewqlyilqsfpgigrrtaerilerfgslerf
    ftaskaeiskvegigekraeeikkilmtpyk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bhnB (B:)
    rprvyvdvreerspvpsileslgvqvipkqlpmgdylvsdsiiverktssdfakslfdgr
    lfeqasrlaehyetvfiivegppvprryrgrerslyaamaalqldygirlmntmdpkgta
    lvieslarlstreggqrivihkkprlsdvrewqlyilqsfpgigrrtaerilerfgsler
    fftaskaeiskvegigekraeeikkilmtpykrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bhnB (B:)
    prvyvdvreerspvpsileslgvqvipkqlpmgdylvsdsiiverktssdfakslfdgrl
    feqasrlaehyetvfiivegppvprryrgrerslyaamaalqldygirlmntmdpkgtal
    vieslarlstrrlsdvrewqlyilqsfpgigrrtaerilerfgslerfftaskaeiskve
    gigekraeeikkilmtpyk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2bhnC (C:)
    rprvyvdvreerspvpsileslgvqvipkqlpmgdylvsdsiiverktssdfakslfdgr
    lfeqasrlaehyetvfiivegppvprryrgrerslyaamaalqldygirlmntmdpkgta
    lvieslarlstreggqrivihkkprlsdvrewqlyilqsfpgigrrtaerilerfgsler
    fftaskaeiskvegigekraeeikkilmtpykrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bhnC (C:)
    rvyvdvreerspvpsileslgvqvipkqlpmgdylvsdsiiverktssdfakslfdgrlf
    eqasrlaehyetvfiivegppvprryrgrerslyaamaalqldygirlmntmdpkgtalv
    ieslarlssdvrewqlyilqsfpgigrrtaerilerfgslerfftaskaeiskvegigek
    raeeikkilmtpyk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2bhnD (D:)
    rprvyvdvreerspvpsileslgvqvipkqlpmgdylvsdsiiverktssdfakslfdgr
    lfeqasrlaehyetvfiivegppvprryrgrerslyaamaalqldygirlmntmdpkgta
    lvieslarlstreggqrivihkkprlsdvrewqlyilqsfpgigrrtaerilerfgsler
    fftaskaeiskvegigekraeeikkilmtpykrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bhnD (D:)
    prvyvdvreerspvpsileslgvqvipkqlpmgdylvsdsiiverktssdfakslfdgrl
    feqasrlaehyetvfiivegppvprryrgrerslyaamaalqldygirlmntmdpkgtal
    vieslarlstreggqrivihkkprlsdvrewqlyilqsfpgigrrtaerilerfgslerf
    ftaskaeiskvegigekraeeikkilmtpyk