PDB entry 2bgw

View 2bgw on RCSB PDB site
Description: xpf from aeropyrum pernix, complex with DNA
Class: hydrolase
Keywords: structure specific endonuclease, nucleotide excision repair, hydrolase
Deposited on 2005-01-06, released 2005-02-23
The last revision prior to the SCOP 1.75 freeze date was dated 2005-06-15, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.225
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: xpf endonuclease
    Species: Aeropyrum pernix
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2bgwa1, d2bgwa2
  • Chain 'B':
    Compound: xpf endonuclease
    Species: Aeropyrum pernix
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2bgwb1, d2bgwb2
  • Chain 'C':
    Compound: 5'-d(*gp*ap*tp*cp*ap*cp*ap*gp*ap*tp *gp*cp*tp*gp*a)-3'
  • Chain 'D':
    Compound: 5'-d(*tp*cp*ap*gp*cp*ap*tp*cp*tp*gp *tp*gp*ap*tp*c)-3'
  • Heterogens: MG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bgwA (A:)
    mledpggrprvyvdvreerspvpsileslgvqvipkqlpmgdylvsdsiiverktssdfa
    kslfdgrlfeqasrlaehyetvfiivegppvprryrgrerslyaamaalqldygirlmnt
    mdpkgtalvieslarlstreggqrivihkkprlsdvrewqlyilqsfpgigrrtaerile
    rfgslerfftaskaeiskvegigekraeeikkilmtpyk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bgwB (B:)
    mledpggrprvyvdvreerspvpsileslgvqvipkqlpmgdylvsdsiiverktssdfa
    kslfdgrlfeqasrlaehyetvfiivegppvprryrgrerslyaamaalqldygirlmnt
    mdpkgtalvieslarlstreggqrivihkkprlsdvrewqlyilqsfpgigrrtaerile
    rfgslerfftaskaeiskvegigekraeeikkilmtpyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bgwB (B:)
    rprvyvdvreerspvpsileslgvqvipkqlpmgdylvsdsiiverktssdfakslfdgr
    lfeqasrlaehyetvfiivegppvprryrgrerslyaamaalqldygirlmntmdpkgta
    lvieslarlstkprlsdvrewqlyilqsfpgigrrtaerilerfgslerfftaskaeisk
    vegigekraeeikkilmtpy
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.