PDB entry 2bgd

View 2bgd on RCSB PDB site
Description: structure-based design of protein tyrosine phosphatase-1b inhibitors
Class: hydrolase
Keywords: protein tyrosine phosphatase, 1, 2, 5-thiadiazolidin-3-one-1, 1-dioxide template, hydrolase
Deposited on 2004-12-21, released 2005-05-04
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.166
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein-tyrosine phosphatase non-receptor type 1
    Species: HOMO SAPIENS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2bgda_
  • Heterogens: T1D, CL, PO4, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bgdA (A:)
    memekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklh
    qedndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslk
    caqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwp
    dfgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkd
    pssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimgdssvqdqwkelshedle
    pppehipppprppkrilephn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bgdA (A:)
    memekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklh
    ndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslkcaq
    ywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwpdfg
    vpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkdpss
    vdikkvllemrkfrmgliqtadqlrfsylaviegakfimgdssvqdqwkelshed