PDB entry 2bg1

View 2bg1 on RCSB PDB site
Description: active site restructuring regulates ligand recognition in classa penicillin-binding proteins (pbps)
Class: peptidoglycan
Keywords: peptidoglycan, peptidoglycan synthesis multifunctional enzyme, cell wall
Deposited on 2004-12-16, released 2005-03-11
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.2019
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: penicillin-binding protein 1b
    Species: Streptococcus pneumoniae [TaxId:171101]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot O70038
      • engineered mutation (388-389)
    Domains in SCOPe 2.05: d2bg1a1
  • Heterogens: SO4, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bg1A (A:)
    dissiseitysdgtviasiesdmlrqdflpsgtvtgisqdylyfttlaeaqermydylaq
    rdnvsakelkneatqkfyrdlaakeienggykitttidqkihsamqsavadygyllddgt
    grvevgnvlmdnqtgailgfvggrnyqenqnnhafdtkrspasttkpllaygiaidqglm
    gsetilsnyptnfangnpimyanskgtgmmtlgealnyswnipaywtyrmlrengvdvkg
    ymekmgyeipeygieslpmgggievtvaqhtngyqtlanngvyhqkhviskieaadgrvv
    yeyqdkpvqvyskatatimqgllrevlssrvtttfksnltslnptlanadwigktgttnq
    denmwlmlstprltlggwighddnhslsqqagysnnsnymahlvnaiqqaspsiwgnerf
    aldpsvvksevlkstgqkpgkvsvegkevevtgstvtsywanksgapatsyrfaiggsda
    dyqnawssivgslp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bg1A (A:)
    itydylyfttlaeaqermydylaqrdnvsakelkneatqkfyrdlaakeienggykittt
    idqkihsamqsavadygyllddgtgrvevgnvlmdnqtgailgfvggrnyqenqnnhafd
    tkrspasttkpllaygiaidqglmgsetilsnyptnfangnpimyanskgtgmmtlgeal
    nyswnipaywtyrmlrengvdvkgymekmgyeipeygieslpmgggievtvaqhtngyqt
    lanngvyhqkhviskieaadgrvvyeyqdkpvqvyskatatimqgllrevlssrvtttfk
    snltslnptlanadwigktgttnqdenmwlmlstprltlggwighddnhslsqqagysnn
    snymahlvnaiqqaspsiwgnerfaldpsvvksevlkstgqkpgkvsvegkevevtgstv
    tsywanksgapatsyrfaiggsdadyqnawssivgs