PDB entry 2ber

View 2ber on RCSB PDB site
Description: y370g active site mutant of the sialidase from micromonospora viridifaciens in complex with beta-neu5ac (sialic acid).
Class: hydrolase
Keywords: glycosidase, hydrolase, sialidase, beta-propeller, micromonospora viridifaciens
Deposited on 2004-11-30, released 2005-04-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.143
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bacterial sialidase
    Species: MICROMONOSPORA VIRIDIFACIENS [TaxId:1881]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02834 (0-600)
      • engineered mutation (323)
    Domains in SCOPe 2.07: d2bera1, d2bera2, d2bera3
  • Heterogens: SLB, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2berA (A:)
    geplyteqdlavngregfpnyripaltvtpdgdllasydgrptgidapgpnsilqrrstd
    ggrtwgeqqvvsagqttapikgfsdpsylvdretgtifnfhvysqrqgfagsrpgtdpad
    pnvlhanvatstdggltwshrtitaditpdpgwrsrfaasgegiqlrygphagrliqqyt
    iinaagafqavsvysddhgrtwrageavgvgmdenktvelsdgrvllnsrdsarsgyrkv
    avstdgghsygpvtidrdlpdptnnasiirafpdapagsarakvllfsnaasqtsrsqgt
    irmscddgqtwpvskvfqpgsmsgstltalpdgtygllyepgtgiryanfnlawlggica
    pftipdvalepgqqvtvpvavtnqsgiavpkpslqldaspdwqvqgsveplmpgrqakgq
    vtitvpagttpgryrvgatlrtsagnasttftvtvglldqarmsiadvdseetaredgra
    snvidgnpstfwhtewsradapgyphrisldlggthtisglqytrrqnsaneqvadyeiy
    tslngttwdgpvasgrfttslapqravfpardaryirlvalseqtghkyaavaelevegq
    r