PDB entry 2bec

View 2bec on RCSB PDB site
Description: Crystal structure of CHP2 in complex with its binding region in NHE1 and insights into the mechanism of pH regulation
Class: metal binding protein/transport protein
Keywords: Calcineurin-homologous protein, Calcium-binding protein, NHE1 regulating protein, METAL BINDING PROTEIN/TRANSPORT PROTEIN COMPLEX
Deposited on 2005-10-24, released 2006-06-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.218
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Calcineurin B homologous protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2beca_
  • Chain 'B':
    Compound: sodium/hydrogen exchanger 1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Heterogens: YT3

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2becA (A:)
    mgsrsshaavipdgdsirretgfsqasllrlhhrfraldrnkkgylsrmdlqqigalavn
    plgdriiesffpdgsqrvdfpgfvrvlahfrpvededtetqdpkkpeplnsrrnklhyaf
    qlydldrdgkisrhemlqvlrlmvgvqvteeqleniadrtvqeadedgdgavsfveftks
    lekmdveqkmsirilkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2becA (A:)
    ipdgdsirretgfsqasllrlhhrfraldrnkkgylsrmdlqqigalavnplgdriiesf
    fpdgsqrvdfpgfvrvlahfrpvededtekpeplnsrrnklhyafqlydldrdgkisrhe
    mlqvlrlmvgvqvteeqleniadrtvqeadedgdgavsfveftkslekmdveqkmsiril
    k
    

  • Chain 'B':
    No sequence available.