PDB entry 2bcv

View 2bcv on RCSB PDB site
Description: DNA polymerase lambda in complex with Dttp and a DNA duplex containing an unpaired Dtmp
Class: Transferase, Lyase/DNA
Keywords: misalignment, extrahelical, mutagenesis, mutation, deletion, streisinger, slippage
Deposited on 2005-10-19, released 2006-03-07
The last revision prior to the SCOP 1.73 freeze date was dated 2006-03-07, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.204
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase lambda
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2bcva1, d2bcva2, d2bcva3
  • Chain 'D':
    Compound: 5'-d(p*gp*cp*cp*g)-3'
  • Chain 'P':
    Compound: 5'-d(*cp*ap*gp*tp*ap*(o2c))-3'
  • Chain 'T':
    Compound: 5'-d(*cp*gp*gp*cp*ap*gp*tp*tp*ap*cp*tp*g)-3'
  • Heterogens: MG, NA, TTP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bcvA (A:)
    maqpssqkatnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeac
    sipgigkrmaekiieilesghlrkldhisesvpvlelfsniwgagtktaqmwyqqgfrsl
    edirsqaslttqqaiglkhysdflermpreeateieqtvqkaaqafnsgllcvacgsyrr
    gkatcgdvdvlithpdgrshrgifsrlldslrqegfltddlvsqeengqqqkylgvcrlp
    gpgrrhrrldiivvpysefacallyftgsahfnrsmralaktkgmslsehalstavvrnt
    hgckvgpgrvlptptekdvfrllglpyrepaerdw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bcvA (A:)
    nlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipgigkrmaek
    iieilesghlrkldhisesvpvlelfsniwgagtktaqmwyqqgfrsledirsqaslttq
    qaiglkhysdflermpreeateieqtvqkaaqafnsgllcvacgsyrrgkatcgdvdvli
    thpdgrshrgifsrlldslrqegfltddlvsqeengqqqkylgvcrlpgpgrrhrrldii
    vvpysefacallyftgsahfnrsmralaktkgmslsehalstavvrnthgckvgpgrvlp
    tptekdvfrllglpyrepaerdw
    

  • Chain 'D':
    No sequence available.

  • Chain 'P':
    No sequence available.

  • Chain 'T':
    No sequence available.