PDB entry 2bcq

View 2bcq on RCSB PDB site
Description: DNA polymerase lambda in complex with a DNA duplex containing an unpaired Dtmp
Class: Transferase, Lyase/DNA
Keywords: misalignment, extrahelical, mutagenesis, mutation, deletion, streisinger, slippage, Transferase, Lyase/DNA COMPLEX
Deposited on 2005-10-19, released 2006-03-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.201
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase lambda
    Species: Homo sapiens [TaxId:9606]
    Gene: POLL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2bcqa1, d2bcqa2, d2bcqa3
  • Chain 'D':
    Compound: 5'-d(p*gp*cp*cp*g)-3'
  • Chain 'P':
    Compound: 5'-d(*cp*ap*gp*tp*ap*cp*g)-3'
  • Chain 'T':
    Compound: 5'-d(*cp*gp*gp*cp*cp*gp*tp*tp*ap*cp*tp*g)-3'
  • Heterogens: NA, MG, PPV, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bcqA (A:)
    maqpssqkatnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeac
    sipgigkrmaekiieilesghlrkldhisesvpvlelfsniwgagtktaqmwyqqgfrsl
    edirsqaslttqqaiglkhysdflermpreeateieqtvqkaaqafnsgllcvacgsyrr
    gkatcgdvdvlithpdgrshrgifsrlldslrqegfltddlvsqeengqqqkylgvcrlp
    gpgrrhrrldiivvpysefacallyftgsahfnrsmralaktkgmslsehalstavvrnt
    hgckvgpgrvlptptekdvfrllglpyrepaerdw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bcqA (A:)
    hnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipgigkrmae
    kiieilesghlrkldhisesvpvlelfsniwgagtktaqmwyqqgfrsledirsqasltt
    qqaiglkhysdflermpreeateieqtvqkaaqafnsgllcvacgsyrrgkatcgdvdvl
    ithpdgrshrgifsrlldslrqegfltddlvsqeengqqqkylgvcrlpgpgrrhrrldi
    ivvpysefacallyftgsahfnrsmralaktkgmslsehalstavvrnthgckvgpgrvl
    ptptekdvfrllglpyrepaerdw
    

  • Chain 'D':
    No sequence available.

  • Chain 'P':
    No sequence available.

  • Chain 'T':
    No sequence available.