PDB entry 2bcc

View 2bcc on RCSB PDB site
Description: stigmatellin-bound cytochrome bc1 complex from chicken
Deposited on 1998-09-18, released 1999-08-02
The last revision prior to the SCOP 1.57 freeze date was dated 2000-12-06, with a file datestamp of 2000-12-06.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.284
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bccA (A:)
    yaqalqsvpetqvsqldngvrvaseqssqptctvgvwidagsryeseknngagyflehla
    fkgtknrpqnalekevesmgahlnayssrehtayyikalskdvpkavelladivqncsle
    dsqiekerdvivrelqendtsmrevvfnylhatafqgtglaqsvegpsenirklsradlt
    eylsthytaprmvlaaaggvehqqllelaqkhfggvpftydddavptlskcrftgsqirh
    redglplahvaiavegpgwahpdlvalqvanaiighydrtyggglhsssplasiavtnkl
    cqsfqtfsicysetglfgfyfvcdrmsiddmmfvlqgqwmrlctsisesevlrgknflrn
    alvshldgttpvcedigrelltygrripleeweerlaevdarmvrevcskyiydqcpava
    gpgpieqlpdynrirsgmfwlr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bccB (B:)
    pphpqdleitklpnglviaslenyspgstigvfikagsryenssnlgtshllrlassltt
    kgassfkitrgieavggklsvestrenmaytveclrddveilmefllnvttapefrpwev
    adlqpqlkidkavafqnpqthvienlhaaayrnaladslycpdyrigkvtsvelhdfvqn
    hftsarmalvglgvshpvlknvaeqllnirgglglsgakakyrggeireqngdslvhaai
    vaesaaiggaeanafsvlqhvlganphvkrglnatsslyqavakgvhqpfdvsafnasys
    dsglfgfytisqaayagqvikaaynqvktiaqgnvsnenvqaaknklkakylmsvesseg
    fleevgsqalaagsynppstvlqqidavadadvikaakkfvsrqksmaasgnlghtpfvd
    el
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bccB (B:)
    pphpqdleitklpnglviaslenyspgstigvfikagsryenssnlgtshllrlassltt
    kgassfkitrgieavggklsvestrenmaytveclrddveilmefllnvttapefrpwev
    adlqpqlkidkavafqnpqthvienlhaaayrnaladslycpdyrigkvtsvelhdfvqn
    hftsarmalvglgvshpvlknvaeqllnirgglglsgakakyrggeireqngdslvhaai
    vaesaaiggaeanafsvlqhvlganphvkrgnpfdvsafnasysdsglfgfytisqaaya
    gqvikaaynqvktiaqgnvsnenvqaaknklkakylmsvessegfleevgsqalaagsyn
    ppstvlqqidavadadvikaakkfvsrqksmaasgnlghtpfvdel
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bccC (C:)
    apnirkshpllkminnslidlpapsnisawwnfgsllavclmtqiltglllamhytadts
    lafssvahtcrnvqygwlirnlhangasffficiflhigrglyygsylyketwntgvill
    ltlmatafvgyvlpwgqmsfwgatvitnlfsaipyightlvewawggfsvdnptltrffa
    lhfllpfaiagitiihltflhesgsnnplgissdsdkipfhpyysfkdilgltlmltpfl
    tlalfspnllgdpenftpanplvtpphikpewyflfayailrsipnklggvlalaasvli
    lflipflhkskqrtmtfrplsqtlfwllvanlliltwigsqpvehpfiiigqmaslsyft
    illilfptigtlenkmlny
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bccD (D:)
    sdlelhppsypwshrgplssldhtsirrgfqvykqvcsschsmdyvayrhlvgvcytede
    akalaeevevqdgpnedgemfmrpgklsdyfpkpypnpeaaraanngalppdlsyivrar
    hggedyvfslltgycepptgvsvreglyfnpyfpgqaigmappiyndvlefddgtpatms
    qvakdvctflrwaaepehdhrkrmglkmllmmgllvplvyymkrhkwsvlksrklayrpp
    k
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bccE (E:)
    shtdikvpnfsdyrrppddystkssresdpsrkgfsylvtavttlgvayaaknvvtqfvs
    smsasadvlamskieiklsdipegknmafkwrgkplfvrhrtkkeidqeaavevsqlrdp
    qhdlervkkpewviligvcthlgcvpianagdfggyycpchgshydasgrirkgpaplnl
    evpsyeftsddmvivg
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bccF (F:)
    srwlegirkwyynaagfnkyglmrddtiyenddvkeairrlpenlyddrmfrikraldln
    mrqqilpkeqwtkyeedvpylepylkevirerkereewdk
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bccG (G:)
    rqfghltrvrhlityslspfeqrpfphyfskgvpnvwrrlracilrvappflafyllytw
    gtqefekskrknpaayvn
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bccH (H:)
    lvdplttvreqceqlekcvkarerlelcdervssrsqteedcteelfdflhardhcvahk
    lfnslk
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bccJ (J:)
    tltarlysllfrrtstfaltivvgallferafdqgadaiyehinegklwkhikhkyenk