PDB entry 2bc4

View 2bc4 on RCSB PDB site
Description: Crystal structure of HLA-DM
Class: immune system
Keywords: MHC class II, IMMUNE SYSTEM
Deposited on 2005-10-18, released 2006-05-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.27 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HLA class II histocompatibility antigen, DM alpha chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DMA, DMA, RING6
    Database cross-references and differences (RAF-indexed):
    • GB NP_006111
    Domains in SCOPe 2.07: d2bc4a1, d2bc4a2
  • Chain 'B':
    Compound: HLA class II histocompatibility antigen, DM beta chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DMB, DMB, RING7
    Database cross-references and differences (RAF-indexed):
    • GB NP_002109
    Domains in SCOPe 2.07: d2bc4b1, d2bc4b2
  • Chain 'C':
    Compound: HLA class II histocompatibility antigen, DM alpha chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DMA, DMA, RING6
    Database cross-references and differences (RAF-indexed):
    • GB NP_006111 (Start-202)
      • flag tag (203-205)
    Domains in SCOPe 2.07: d2bc4c1, d2bc4c2, d2bc4c3
  • Chain 'D':
    Compound: HLA class II histocompatibility antigen, DM beta chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DMB, DMB, RING7
    Database cross-references and differences (RAF-indexed):
    • GB NP_002109
    Domains in SCOPe 2.07: d2bc4d1, d2bc4d2
  • Heterogens: NDG, BMA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bc4A (A:)
    vpeaptpmwpddlqnhtflhtvycqdgspsvglseaydedqlfffdfsqntrvprlpefa
    dwaqeqgdapailfdkefcewmiqqigpkldgkipvsrgfpiaevftlkplefgkpntlv
    cfvsnlfppmltvnwqhhsvpvegfgptfvsavdglsfqafsylnftpepsdifscivth
    eidrytaiaywvprnalpsdlledykddddk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bc4A (A:)
    lqnhtflhtvycqdgspsvglseaydedqlfffdfsqntrvprlpefadwaqeqgdapai
    lfdkefcewmiqqigpkldgkipvsrgfpiaevftlkplefgkpntlvcfvsnlfppmlt
    vnwqhhsvpvegfgptfvsavdglsfqafsylnftpepsdifscivtheidrytaiaywv
    prnalpsd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bc4B (B:)
    ggfvahvestcllddagtpkdftycisfnkdlltcwdpeenkmapcefgvlnslanvlsq
    hlnqkdtlmqrlrnglqncathtqpfwgsltnrtrppsvqvakttpfntrepvmlacyvw
    gfypaevtitwrkngklvmphssahktaqpngdwtyqtlshlaltpsygdtytcvvehig
    apepilrdwtpglspmqtlkkpptpppepet
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bc4B (B:)
    fvahvestcllddagtpkdftycisfnkdlltcwdpeenkmapcefgvlnslanvlsqhl
    nqkdtlmqrlrnglqncathtqpfwgsltnrtrppsvqvakttpfntrepvmlacyvwgf
    ypaevtitwrkngklvmphssahktaqpngdwtyqtlshlaltpsygdtytcvvehigap
    epilrdwtpgl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2bc4C (C:)
    vpeaptpmwpddlqnhtflhtvycqdgspsvglseaydedqlfffdfsqntrvprlpefa
    dwaqeqgdapailfdkefcewmiqqigpkldgkipvsrgfpiaevftlkplefgkpntlv
    cfvsnlfppmltvnwqhhsvpvegfgptfvsavdglsfqafsylnftpepsdifscivth
    eidrytaiaywvprnalpsdlledykddddk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bc4C (C:)
    dlqnhtflhtvycqdgspsvglseaydedqlfffdfsqntrvprlpefadwaqeqgdapa
    ilfdkefcewmiqqigpkldgkipvsrgfpiaevftlkplefgkpntlvcfvsnlfppml
    tvnwqhhsvpvegfgptfvsavdglsfqafsylnftpepsdifscivtheidrytaiayw
    vprnalpsdlledyk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2bc4D (D:)
    ggfvahvestcllddagtpkdftycisfnkdlltcwdpeenkmapcefgvlnslanvlsq
    hlnqkdtlmqrlrnglqncathtqpfwgsltnrtrppsvqvakttpfntrepvmlacyvw
    gfypaevtitwrkngklvmphssahktaqpngdwtyqtlshlaltpsygdtytcvvehig
    apepilrdwtpglspmqtlkkpptpppepet
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bc4D (D:)
    fvahvestcllddagtpkdftycisfnkdlltcwdpeenkmapcefgvlnslanvlsqhl
    nqkdtlmqrlrnglqncathtqpfwgsltnrtrppsvqvakttpfntrepvmlacyvwgf
    ypaevtitwrkngklvmphssahktaqpngdwtyqtlshlaltpsygdtytcvvehigap
    epilrdwtpglspmqtl