PDB entry 2bbm

View 2bbm on RCSB PDB site
Description: solution structure of a calmodulin-target peptide complex by multidimensional nmr
Class: calcium-binding protein
Keywords: calcium-binding protein
Deposited on 1992-07-16, released 1994-01-31
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-12.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calmodulin
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2bbma_
  • Chain 'B':
    Compound: myosin light chain kinase
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bbmA (A:)
    adqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgn
    gtidfpefltmmarkmkdtdseeeireafrvfdkdgngfisaaelrhvmtnlgekltdee
    vdemireadidgdgqvnyeefvtmmtsk
    

  • Chain 'B':
    No sequence available.