PDB entry 2baz

View 2baz on RCSB PDB site
Description: Structure of YosS, a putative dUTPase from Bacillus subtilis
Class: unknown function
Keywords: homotrimer, beta barrel, UNKNOWN FUNCTION
Deposited on 2005-10-16, released 2006-10-17
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.217
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hypothetical protein BSU20020
  Species: Bacillus subtilis [TaxId:1423]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O34919 (0-End)
• Chain 'B':
  Compound: hypothetical protein BSU20020
  Species: Bacillus subtilis [TaxId:1423]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O34919 (0-End)
• Chain 'C':
  Compound: hypothetical protein BSU20020
  Species: Bacillus subtilis [TaxId:1423]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O34919 (0-End)
  Domains in SCOPe 2.02: d2bazc_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  Sequence, based on SEQRES records: (download)
  

  >2bazC (C:)
  mqikikyldetqtrinkmeqgdwidlraaedvaikkdefklvplgvamelpegyeahvvp
  rsstyknfgviqtnsmgvidesykgdndfwffpayalrdtkikkgdricqfrimkkmpav
  dlievdrlgngdrgghgstgtk
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2bazC (C:)
  mqikikyldetqtrinkmeqgdwidlraaedvaikkdefklvplgvamelpegyeahvvp
  rsstyknfgviqtnsmgvidesykgdndfwffpayalrdtkikkgdricqfrimkkmpav
  dlievdrl