PDB entry 2baw

View 2baw on RCSB PDB site
Description: Human Nuclear Receptor-Ligand Complex 1
Class: transcription
Keywords: Nuclear Receptor, Protein-Ligand Complex, PPAR, TRANSCRIPTION
Deposited on 2005-10-15, released 2006-01-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-09-28, with a file datestamp of 2011-09-23.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.245
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator activated receptor delta
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q03181 (0-End)
      • conflict (219)
    Domains in SCOPe 2.06: d2bawa_
  • Chain 'B':
    Compound: Peroxisome proliferator activated receptor delta
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q03181 (0-266)
      • conflict (219)
    Domains in SCOPe 2.06: d2bawb_
  • Heterogens: B7G, VCA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bawA (A:)
    lkafskhiynaylknfnmtkkkarsiltgkashtapfvihdietlwqaekglvwkqlvng
    lppykeisvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvheaifaml
    asivnkdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlalfiaa
    iilcgdrpglmnvprveaiqdtilralefhlqanhpdaqqlfpkllqkmadlrqlvteha
    qmmqrikktetetslhpllqeiykdmy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bawA (A:)
    lkafskhiynaylknfnmtkkkarsiltkapfvihdietlwqaekglvwkeisvhvfyrc
    qcttvetvreltefaksipsfsslflndqvtllkygvheaifamlasivnkdgllvangs
    gfvtreflrslrkpfsdiiepkfefavkfnalelddsdlalfiaaiilcgdrpglmnvpr
    veaiqdtilralefhlqanhpdaqqlfpkllqkmadlrqlvtehaqmmqrikktetetsl
    hpllqeiykd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bawB (B:)
    lkafskhiynaylknfnmtkkkarsiltgkashtapfvihdietlwqaekglvwkqlvng
    lppykeisvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvheaifaml
    asivnkdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlalfiaa
    iilcgdrpglmnvprveaiqdtilralefhlqanhpdaqqlfpkllqkmadlrqlvteha
    qmmqrikktetetslhpllqeiykdmy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bawB (B:)
    lkafskhiynaylknfnmtkkkarsiltpfvihdietlwqaekglkeisvhvfyrcqctt
    vetvreltefaksipsfsslflndqvtllkygvheaifamlasivnkdgllvangsgfvt
    reflrslrkpfsdiiepkfefavkfnalelddsdlalfiaaiilcgdrpglmnvprveai
    qdtilralefhlqanhpdaqqlfpkllqkmadlrqlvtehaqmmqrikktetetslhpll
    qeiykdmy