PDB entry 2baa

View 2baa on RCSB PDB site
Description: the refined crystal structure of an endochitinase from hordeum vulgare l. seeds to 1.8 angstroms resolution
Class: hydrolase (o-glycosyl)
Keywords: hydrolase (o-glycosyl)
Deposited on 1995-01-26, released 1996-01-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.18
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endochitinase (26 kd)
    Species: Hordeum vulgare [TaxId:4513]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2baaa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2baaA (A:)
svssivsraqfdrmllhrndgacqakgfytydafvaaaaafpgfgttgsadaqkrevaaf
laqtshettggwatapdgafawgycfkqergassdyctpsaqwpcapgkryygrgpiqls
hnynygpagraigvdllanpdlvatdatvgfktaiwfwmtaqppkpsshaviagqwspsg
adraagrvpgfgvitniinggiecghgqdsrvadrigfykrycdilgvgygnnldcysqr
pfa