PDB entry 2b8x

View 2b8x on RCSB PDB site
Description: Crystal stucture of the interleukin-4 variant F82D
Class: cytokine
Keywords: four helix bundle, CYTOKINE
Deposited on 2005-10-10, released 2006-05-30
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.228
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: interleukin-4
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P05112 (0-128)
    • engineered (81)
  Domains in SCOPe 2.04: d2b8xa_
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2b8xA (A:)
  hkcditlqeiiktlnslteqktlcteltvtdifaaskntteketfcraatvlrqfyshhe
  kdtrclgataqqfhrhkqlirdlkrldrnlwglaglnscpvkeanqstlenflerlktim
  rekyskcss