PDB entry 2b8w

View 2b8w on RCSB PDB site
Description: Crystal-structure of the N-terminal Large GTPase Domain of human Guanylate Binding protein 1 (hGBP1) in complex with GMP/AlF4
Class: signaling protein
Keywords: protein- guanine nucleotide complex, SIGNALING PROTEIN
Deposited on 2005-10-10, released 2006-03-07
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.22 Å
R-factor: 0.193
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: interferon-induced guanylate-binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: GBP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2b8wa1, d2b8wa2
  • Chain 'B':
    Compound: interferon-induced guanylate-binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: GBP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2b8wb1, d2b8wb2
  • Heterogens: MG, ALF, 5GP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2b8wA (A:)
    mhhhhhhmrgsmaseihmtgpmclientngrlmanpealkilsaitqpmvvvaivglyrt
    gksylmnklagkkkgfslgstvqshtkgiwmwcvphpkkpghilvlldteglgdvekgdn
    qndswifalavllsstfvynsigtinqqamdqlyyvtelthrirsksspdenenevedsa
    dfvsffpdfvwtlrdfsldleadgqpltpdeyltyslklkkgtsqkdetfnlprlcirkf
    fpkkkcfvfdrpvhrrklaqleklqdeeldpefvqqvadfcsyifsnsktktlsggiqvn
    gprleslvltyvnaissgdlpcmenavl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b8wA (A:)
    hmtgpmclientngrlmanpealkilsaitqpmvvvaivglyrtgksylmnklagkkkgf
    slgstvqshtkgiwmwcvphpkkpghilvlldteglgdvekgdnqndswifalavllsst
    fvynsigtinqqamdqlyyvtelthrirsksvsffpdfvwtlrdfsldleadgqpltpde
    yltyslklkkgtsqkdetfnlprlcirkffpkkkcfvfdrpvhrrklaqleklqdeeldp
    efvqqvadfcsyifsnsktktlsggiqvngprleslvltyvnaissgd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2b8wB (B:)
    mhhhhhhmrgsmaseihmtgpmclientngrlmanpealkilsaitqpmvvvaivglyrt
    gksylmnklagkkkgfslgstvqshtkgiwmwcvphpkkpghilvlldteglgdvekgdn
    qndswifalavllsstfvynsigtinqqamdqlyyvtelthrirsksspdenenevedsa
    dfvsffpdfvwtlrdfsldleadgqpltpdeyltyslklkkgtsqkdetfnlprlcirkf
    fpkkkcfvfdrpvhrrklaqleklqdeeldpefvqqvadfcsyifsnsktktlsggiqvn
    gprleslvltyvnaissgdlpcmenavl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b8wB (B:)
    hmtgpmclientngrlmanpealkilsaitqpmvvvaivglyrtgksylmnklagkkkgf
    slgstvqshtkgiwmwcvphpkkpghilvlldteglgdvekgdnqndswifalavllsst
    fvynsigtinqqamdqlyyvtelthrirskssvsffpdfvwtlrdfsldleadgqpltpd
    eyltyslklkkgtsqkdetfnlprlcirkffpkkkcfvfdrpvhrrklaqleklqdeeld
    pefvqqvadfcsyifsnsktktlsggiqvngprleslvltyvnaissgdl