PDB entry 2b4s

View 2b4s on RCSB PDB site
Description: Crystal structure of a complex between PTP1B and the insulin receptor tyrosine kinase
Class: Hydrolase/transferase
Keywords: Hydrolase/transferase, phosphorylation, tyrosine protein kinase
Deposited on 2005-09-26, released 2005-11-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.208
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein phosphatase, non-receptor type 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PTPN1, PTP1B
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18031
      • engineered (214)
    Domains in SCOPe 2.04: d2b4sa_
  • Chain 'B':
    Compound: Insulin receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: INSR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06213 (Start-305)
      • modified residue (180)
      • modified residue (184-185)
      • natural variants (273)
    Domains in SCOPe 2.04: d2b4sb_
  • Chain 'C':
    Compound: Tyrosine-protein phosphatase, non-receptor type 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PTPN1, PTP1B
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18031
      • engineered (214)
    Domains in SCOPe 2.04: d2b4sc_
  • Chain 'D':
    Compound: Insulin receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: INSR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06213 (Start-305)
      • modified residue (180)
      • modified residue (184-185)
      • natural variants (273)
    Domains in SCOPe 2.04: d2b4sd_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2b4sA (A:)
    memekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklh
    qedndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslk
    caqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwp
    dfgvpespasflnflfkvresgslspehgpvvvhasagigrsgtfcladtclllmdkrkd
    pssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimgdssvqdqwkelshed
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b4sA (A:)
    emekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklhq
    edndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmgslkcaq
    ywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwpdfg
    vpespasflnflfkvresgslspehgpvvvhasagigrsgtfcladtclllmdkrkdpss
    vdikkvllemrkfrmgliqtadqlrfsylaviegakfimgdssvqdqwk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2b4sB (B:)
    vfpssvyvpdewevsrekitllrelgqgsfgmvyegnardiikgeaetrvavktvnesas
    lrerieflneasvmkgftchhvvrllgvvskgqptlvvmelmahgdlksylrslrpeaen
    npgrppptlqemiqmaaeiadgmaylnakkfvhrdlaarncmvahdftvkigdfgmtrdi
    yetdyyrkggkgllpvrwmapeslkdgvfttssdmwsfgvvlweitslaeqpyqglsneq
    vlkfvmdggyldqpdncpervtdlmrmcwqfnpnmrptfleivnllkddlhpsfpevsff
    hseenk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b4sB (B:)
    dewevsrekitllrelgqgsfgmvyegnardiikgeaetrvavktvnesaslreriefln
    easvmkgftchhvvrllgvvskgqptlvvmelmahgdlksylrslrpeaennpgrppptl
    qemiqmaaeiadgmaylnakkfvhrdlaarncmvahdftvkigdfgmtrdiyetdyyrkg
    gkgllpvrwmapeslkdgvfttssdmwsfgvvlweitslaeqpyqglsneqvlkfvmdgg
    yldqpdncpervtdlmrmcwqfnpnmrptfleivnllkddlhpsfpevsffhseenk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2b4sC (C:)
    memekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklh
    qedndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslk
    caqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwp
    dfgvpespasflnflfkvresgslspehgpvvvhasagigrsgtfcladtclllmdkrkd
    pssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimgdssvqdqwkelshed
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b4sC (C:)
    emekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklhq
    edndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmslkcaqy
    wpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwpdfgv
    pespasflnflfkvresgslspehgpvvvhasagigrsgtfcladtclllmdkrkdpssv
    dikkvllemrkfrmgliqtadqlrfsylaviegakfim
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2b4sD (D:)
    vfpssvyvpdewevsrekitllrelgqgsfgmvyegnardiikgeaetrvavktvnesas
    lrerieflneasvmkgftchhvvrllgvvskgqptlvvmelmahgdlksylrslrpeaen
    npgrppptlqemiqmaaeiadgmaylnakkfvhrdlaarncmvahdftvkigdfgmtrdi
    yetdyyrkggkgllpvrwmapeslkdgvfttssdmwsfgvvlweitslaeqpyqglsneq
    vlkfvmdggyldqpdncpervtdlmrmcwqfnpnmrptfleivnllkddlhpsfpevsff
    hseenk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b4sD (D:)
    dewevsrekitllrelgqgsfgmvyegnardiikgeaetrvavktvnesaslreriefln
    easvmkgftchhvvrllgvvskgqptlvvmelmahgdlksylrslrpeaennpgrppptl
    qemiqmaaeiadgmaylnakkfvhrdlaarncmvahdftvkigdfgmtrdiyetdyyrkg
    gkgllpvrwmapeslkdgvfttssdmwsfgvvlweitslaeqpyqglsneqvlkfvmdgg
    yldqpdncpervtdlmrmcwqfnpnmrptfleivnllkddlhpsfpevsffhseenk