PDB entry 2b2p

View 2b2p on RCSB PDB site
Description: Binding of chitin-like polysaccharides to protective signalling factor: crystal structure of the complex of signalling protein from sheep (SPS-40) with a pentasaccharide at 2.8 A resolution
Class: unknown function
Keywords: signalling protein, pentasaccharide, complex, crystal structure, SPS-40
Deposited on 2005-09-19, released 2005-09-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2006-08-01, with a file datestamp of 2007-06-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.195
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Signal Processing Protein, SPS-40
    Species: Ovis aries
    Gene:
    Database cross-references and differences (RAF-indexed):
    • GB AAQ94054 (0-360)
    Domains in SCOPe 2.07: d2b2pa1, d2b2pa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2b2pA (A:)
    yklicyytswsqyregdgscfpdaidpflcthviysfanisnneidtwewndvtlydtln
    tlknrnpklktllsvggwnfgperfsaiasktqsrrtfiksvppflrthgfdgldlawly
    pgrrdkrhlttlvkemkaefireaqagteqlllsaavsagkiaidrgydiaqisrhldfi
    slltydfhgawrqtvghhsplfagnedassrfsnadyavsymlrlgapanklvmgiptfg
    rsftlassktdvgapvsgpgvpgrftkekgilayyeicdflhgatthrfrdqqvpyatkg
    nqwvayddqesvknkarylknrqlagamvwaldlddfrgtfcgqnltfpltsavkdvlae
    v