PDB entry 2b1x

View 2b1x on RCSB PDB site
Description: Crystal structure of naphthalene 1,2-dioxygenase from Rhodococcus sp.
Class: oxidoreductase
Keywords: rieske non-heme iron oxygenase, oxidoreductase
Deposited on 2005-09-16, released 2005-10-04
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.191
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: naphthalene dioxygenase large subunit
    Species: Rhodococcus sp. [TaxId:92694]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2b1xa1, d2b1xa2
  • Chain 'B':
    Compound: naphthalene dioxygenase small subunit
    Species: Rhodococcus sp. [TaxId:92694]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2b1xb1
  • Chain 'C':
    Compound: naphthalene dioxygenase large subunit
    Species: Rhodococcus sp. [TaxId:92694]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2b1xc1, d2b1xc2
  • Chain 'D':
    Compound: naphthalene dioxygenase small subunit
    Species: Rhodococcus sp. [TaxId:92694]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2b1xd_
  • Chain 'E':
    Compound: naphthalene dioxygenase large subunit
    Species: Rhodococcus sp. [TaxId:92694]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2b1xe1, d2b1xe2
  • Chain 'F':
    Compound: naphthalene dioxygenase small subunit
    Species: Rhodococcus sp. [TaxId:92694]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2b1xf_
  • Heterogens: FE, FES, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2b1xA (A:)
    mlsnelrqtlqkglhdvnsdwtvpaaiindpevhdvererifghawvflaheseipergd
    yvvryisedqfivcrdeggeirghlnacrhrgmqvcraemgntshfrcpyhgwtysntgs
    lvgvpagkdaygnqlkksdwnlrpmpnlasykglifgsldphadsledylgdlkfyldiv
    ldrsdaglqvvgapqrwvidanwklgadnfvgdayhtmmthrsmvelglappdpqfalyg
    ehihtghghglgiigpppgmplpefmglpeniveelerrltpeqveifrptafihgtvfp
    nlsignflmgkdhlsaptafltlrlwhplgpdkmevmsfflvekdapdwfkdesyksylr
    tfgisggfeqddaenwrsitrvmggqfaktgelnyqmgrgvlepdpnwtgpgeaypldya
    eanqrnfleywmqlmlaesplrdgnsngsgtadastpaaakskspakaea
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b1xA (A:)
    mlsnelrqtlqkglhdvnsdwtvpaaiindpevhdvererifghawvflaheseipergd
    yvvryisedqfivcrdeggeirghlnacrhrgmqvcraemgntshfrcpyhgwtysntgs
    lvgvpagkdaygnqlkksdwnlrpmpnlasykglifgsldphadsledylgdlkfyldiv
    ldrsdaglqvvgapqrwvidanwklgadnfvgdayhtmmthrsmvelglappdpqfalyg
    ehihtghghglgiigpppgmplpefmglpeniveelerrltpeqveifrptafihgtvfp
    nlsignflmgkdhlsaptafltlrlwhplgpdkmevmsfflvekdapdwfkdesyksylr
    tfgisggfeqddaenwrsitrvmggqfaktgelnyqmgrgvlepdpnwtgpgeaypldya
    eanqrnfleywmqlmlaespl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2b1xB (B:)
    mntqtrvsdttvreitewlymeaelldagkyrewlalvtedlsyvvpirvtrereavtdv
    vegmthmdddadsmemrvlrleteyawaedppsrsrhfvtnvrvatgdsedefkvtsnll
    lyrtrgdvatydvlsgertdvlrragdsflmakrvvlldqttimthnlalim
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b1xB (B:)
    rvsdttvreitewlymeaelldagkyrewlalvtedlsyvvpirvtrereavtdvvegmt
    hmdddadsmemrvlrleteyawaedppsrsrhfvtnvrvatgdsedefkvtsnlllyrtr
    gdvatydvlsgertdvlrragdsflmakrvvlldqttimthnlalim
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2b1xC (C:)
    mlsnelrqtlqkglhdvnsdwtvpaaiindpevhdvererifghawvflaheseipergd
    yvvryisedqfivcrdeggeirghlnacrhrgmqvcraemgntshfrcpyhgwtysntgs
    lvgvpagkdaygnqlkksdwnlrpmpnlasykglifgsldphadsledylgdlkfyldiv
    ldrsdaglqvvgapqrwvidanwklgadnfvgdayhtmmthrsmvelglappdpqfalyg
    ehihtghghglgiigpppgmplpefmglpeniveelerrltpeqveifrptafihgtvfp
    nlsignflmgkdhlsaptafltlrlwhplgpdkmevmsfflvekdapdwfkdesyksylr
    tfgisggfeqddaenwrsitrvmggqfaktgelnyqmgrgvlepdpnwtgpgeaypldya
    eanqrnfleywmqlmlaesplrdgnsngsgtadastpaaakskspakaea
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b1xC (C:)
    mlsnelrqtlqkglhdvnsdwtvpaaiindpevhdvererifghawvflaheseipergd
    yvvryisedqfivcrdeggeirghlnacrhrgmqvcraemgntshfrcpyhgwtysntgs
    lvgvpagkdaygnqlkksdwnlrpmpnlasykglifgsldphadsledylgdlkfyldiv
    ldrsdaglqvvgapqrwvidanwklgadnfvgdayhtmmthrsmvelglappdpqfalyg
    ehihtghghglgiigpppgmplpefmglpeniveelerrltpeqveifrptafihgtvfp
    nlsignflmgkdhlsaptafltlrlwhplgpdkmevmsfflvekdapdwfkdesyksylr
    tfgisggfeqddaenwrsitrvmggqfaktgelnyqmgrgvlepdpnwtgpgeaypldya
    eanqrnfleywmqlmlaespl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2b1xD (D:)
    mntqtrvsdttvreitewlymeaelldagkyrewlalvtedlsyvvpirvtrereavtdv
    vegmthmdddadsmemrvlrleteyawaedppsrsrhfvtnvrvatgdsedefkvtsnll
    lyrtrgdvatydvlsgertdvlrragdsflmakrvvlldqttimthnlalim
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b1xD (D:)
    rvsdttvreitewlymeaelldagkyrewlalvtedlsyvvpirvtrereavtdvvegmt
    hmdddadsmemrvlrleteyawaedppsrsrhfvtnvrvatgdsedefkvtsnlllyrtr
    gdvatydvlsgertdvlrragdsflmakrvvlldqttimthnlalim
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2b1xE (E:)
    mlsnelrqtlqkglhdvnsdwtvpaaiindpevhdvererifghawvflaheseipergd
    yvvryisedqfivcrdeggeirghlnacrhrgmqvcraemgntshfrcpyhgwtysntgs
    lvgvpagkdaygnqlkksdwnlrpmpnlasykglifgsldphadsledylgdlkfyldiv
    ldrsdaglqvvgapqrwvidanwklgadnfvgdayhtmmthrsmvelglappdpqfalyg
    ehihtghghglgiigpppgmplpefmglpeniveelerrltpeqveifrptafihgtvfp
    nlsignflmgkdhlsaptafltlrlwhplgpdkmevmsfflvekdapdwfkdesyksylr
    tfgisggfeqddaenwrsitrvmggqfaktgelnyqmgrgvlepdpnwtgpgeaypldya
    eanqrnfleywmqlmlaesplrdgnsngsgtadastpaaakskspakaea
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b1xE (E:)
    mlsnelrqtlqkglhdvnsdwtvpaaiindpevhdvererifghawvflaheseipergd
    yvvryisedqfivcrdeggeirghlnacrhrgmqvcraemgntshfrcpyhgwtysntgs
    lvgvpagkdaygnqlkksdwnlrpmpnlasykglifgsldphadsledylgdlkfyldiv
    ldrsdaglqvvgapqrwvidanwklgadnfvgdayhtmmthrsmvelglappdpqfalyg
    ehihtghghglgiigpppgmplpefmglpeniveelerrltpeqveifrptafihgtvfp
    nlsignflmgkdhlsaptafltlrlwhplgpdkmevmsfflvekdapdwfkdesyksylr
    tfgisggfeqddaenwrsitrvmggqfaktgelnyqmgrgvlepdpnwtgpgeaypldya
    eanqrnfleywmqlmlaespl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2b1xF (F:)
    mntqtrvsdttvreitewlymeaelldagkyrewlalvtedlsyvvpirvtrereavtdv
    vegmthmdddadsmemrvlrleteyawaedppsrsrhfvtnvrvatgdsedefkvtsnll
    lyrtrgdvatydvlsgertdvlrragdsflmakrvvlldqttimthnlalim
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b1xF (F:)
    rvsdttvreitewlymeaelldagkyrewlalvtedlsyvvpirvtrereavtdvvegmt
    hmdddadsmemrvlrleteyawaedppsrsrhfvtnvrvatgdsedefkvtsnlllyrtr
    gdvatydvlsgertdvlrragdsflmakrvvlldqttimthnlalim