PDB entry 2b1p

View 2b1p on RCSB PDB site
Description: inhibitor complex of JNK3
Class: Transferase
Keywords: enzyme-inhibitor complex, kinase inhibitor
Deposited on 2005-09-16, released 2006-09-16
The last revision prior to the SCOP 1.75 freeze date was dated 2006-09-16, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.22
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 10
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2b1pa1
  • Heterogens: SO4, AIZ, BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2b1pA (A:)
    nqfysvevgdstftvlkryqnlkpigsgaqgivcaaydavldrnvaikklsrpfqnqtha
    krayrelvlmkcvnhkniisllnvftpqktleefqdvylvmelmdanlcqviqmeldher
    msyllyqmlcgikhlhsagiihrdlkpsnivvksdctlkildfglartagtsfmmtpyvv
    tryyrapevilgmgykenvdiwsvgcimgemvrhkilfpgrdyidqwnkvieqlgtpcpe
    fmkklqptvrnyvenrpkyagltfpklfpdslfpadsehnklkasqardllskmlvidpa
    krisvddalqhpyinvwydpaeveapppqiydkqlderehtieewkeliykevmn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b1pA (A:)
    nqfysvevgdstftvlkryqnlkpigsggivcaaydavldrnvaikklsrpfqnqthakr
    ayrelvlmkcvnhkniisllnvftpqktleefqdvylvmelmdanlcqviqmeldherms
    yllyqmlcgikhlhsagiihrdlkpsnivvksdctlkildfgltryyrapevilgmgyke
    nvdiwsvgcimgemvrhkilfpgrdyidqwnkvieqlgtpcpefmkklqptvrnyvenrp
    kyagltfpklfpdslfpadsehnklkasqardllskmlvidpakrisvddalqhpyinvw
    ydpaeveapppderehtieewkeliykevmn