PDB entry 2b1m

View 2b1m on RCSB PDB site
Description: Crystal structure of a papain-fold protein without the catalytic cysteine from seeds of Pachyrhizus erosus
Class: sugar binding protein
Keywords: papain-like, SUGAR BINDING PROTEIN
Deposited on 2005-09-16, released 2006-10-03
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.18
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: spe31
    Species: Pachyrhizus erosus [TaxId:109171]
    Database cross-references and differences (RAF-indexed):
    • GB AAZ78496
    Domains in SCOPe 2.04: d2b1ma_
  • Heterogens: PG4, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2b1mA (A:)
    dapeswdwskkgvitkvkfqgqcgsgwafsatgaieaahaiatgnlvslseqelidcvde
    segcyngwhyqsfewvvkhggiaseadypykardgkckaneiqdkvtidnygvqilsnes
    teseaesslqsfvleqpisvsidakdfhfysggiydggncsspyginhfvlivgygsedg
    vdywiaknswgedwgidgyiriqrntgnllgvcgmnyfasypiieksetlkfgrvkadpr
    vehspl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b1mA (A:)
    apeswdwskkgvitkvkfqgqcgsgwafsatgaieaahaiatgnlvslseqelidcvdes
    egcyngwhyqsfewvvkhggiaseadypykardgkckaneiqdkvtidnygvqilsnest
    eseaesslqsfvleqpisvsidakdfhfysggiydggncsspyginhfvlivgygsedgv
    dywiaknswgedwgidgyiriqrntgnllgvcgmnyfasypiiek