PDB entry 2b1a

View 2b1a on RCSB PDB site
Description: Crystal structure analysis of anti-HIV-1 V3 Fab 2219 in complex with UG1033 peptide
Class: immune system
Keywords: Fab-peptide complex; HIV-1; gp120; v3 loop, IMMUNE SYSTEM
Deposited on 2005-09-15, released 2006-07-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Fab 2219, heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2B1A (0-225)
    Domains in SCOPe 2.08: d2b1ah1, d2b1ah2
  • Chain 'L':
    Compound: Fab 2219, light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2B1A (0-214)
  • Chain 'P':
    Compound: UG1033 peptide of Exterior membrane glycoprotein GP120
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • GB CAA80704
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2b1aH (H:)
    eiqleqsgaevkksgeslkiscqtsgysfsdywigwvrqmpgkglewmgifypgdsdsry
    spsfegqvtmsadrstntahlqwsslkpsdtalyycarlggdyedsgadafdfwgqgtlv
    tvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpav
    lqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepks
    

  • Chain 'L':
    No sequence available.

  • Chain 'P':
    No sequence available.