PDB entry 2b0z

View 2b0z on RCSB PDB site
Description: Crystal structure of the protein-protein complex between F82I cytochrome c and cytochrome c peroxidase
Class: oxidoreductase/electron transport
Keywords: cytochrome, electron transfer, OXIDOREDUCTASE-ELECTRON TRANSPORT COMPLEX
Deposited on 2005-09-15, released 2005-10-25
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.263
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c peroxidase, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: CCP1, CCP, CPO
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2b0za_
  • Chain 'B':
    Compound: Cytochrome c iso-1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: CYC1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00044 (0-107)
      • engineered (86)
    Domains in SCOPe 2.05: d2b0zb1
  • Heterogens: ZNH, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2b0zA (A:)
ttplvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhtsgtwdkh
dntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemq
gpkipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahalgkt
hlknsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliq
dpkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2b0zB (B:)
tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
nvlwdennmseyltnpkkyipgtkmaigglkkekdrndlitylkkace