PDB entry 2b0q

View 2b0q on RCSB PDB site
Description: Crystal Structure Of 3',5"-Aminoglycoside Phosphotransferase Type IIIa ADP Neomycin B Complex
Class: transferase
Keywords: protein kinase-like
Deposited on 2005-09-14, released 2005-09-27
The last revision prior to the SCOP 1.73 freeze date was dated 2005-09-27, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.225
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aminoglycoside 3'-phosphotransferase
    Species: Enterococcus faecalis
    Gene: aphA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2b0qa1
  • Heterogens: MG, ADP, NMY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2b0qA (A:)
akmrispelkkliekyrcvkdtegmspakvyklvgenenlylkmtdsrykgttydverek
dmmlwlegklpvpkvlhferhdgwsnllmseadgvlcseeyedeqspekiielyaecirl
fhsidisdcpytnsldsrlaeldyllnndladvdcenweedtpfkdprelydflktekpe
eelvfshgdlgdsnifvkdgkvsgfidlgrsgradkwydiafcvrsiredigeeqyvelf
fdllgikpdwekikyyilldelf