PDB entry 2b05

View 2b05 on RCSB PDB site
Description: Crystal Structure of 14-3-3 gamma in complex with a phosphoserine peptide
Class: cell cycle
Keywords: cell cycle
Deposited on 2005-09-13, released 2005-10-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.259
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 14-3-3 protein gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: YWHAG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2b05a_
  • Chain 'B':
    Compound: 14-3-3 protein gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: YWHAG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2b05b_
  • Chain 'C':
    Compound: 14-3-3 protein gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: YWHAG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2b05c_
  • Chain 'D':
    Compound: 14-3-3 protein gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: YWHAG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2b05d_
  • Chain 'E':
    Compound: 14-3-3 protein gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: YWHAG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2b05e_
  • Chain 'F':
    Compound: 14-3-3 protein gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: YWHAG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2b05f_
  • Chain 'G':
    Compound: peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 2B05 (0-5)
  • Chain 'H':
    Compound: peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 2B05 (0-5)
  • Chain 'I':
    Compound: peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 2B05 (0-5)
  • Chain 'J':
    Compound: peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 2B05 (0-5)
  • Chain 'K':
    Compound: peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 2B05 (Start-5)
  • Chain 'L':
    Compound: peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 2B05 (0-5)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2b05A (A:)
    vdreqlvqkarlaeqaeryddmaaamknvtelneplsneernllsvayknvvgarrsswr
    vissieqktsadgnekkiemvrayrekiekeleavcqdvlslldnylikncsetqyeskv
    fylkmkgdyyrylaevatgekratvvessekayseaheiskehmqpthpirlglalnysv
    fyyeiqnapeqachlaktafddaiaeldtlnedsykdstlimqllrdnltlwtsdqqddd
    ggegnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b05A (A:)
    vdreqlvqkarlaeqaeryddmaaamknvtelneplsneernllsvayknvvgarrsswr
    vissieqktsadgnekkiemvrayrekiekeleavcqdvlslldnylikncsetqyeskv
    fylkmkgdyyrylaevatgekratvvessekayseaheiskehmqpthpirlglalnysv
    fyyeiqnapeqachlaktafddaiaeldtlnedsykdstlimqllrdnltlwt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2b05B (B:)
    vdreqlvqkarlaeqaeryddmaaamknvtelneplsneernllsvayknvvgarrsswr
    vissieqktsadgnekkiemvrayrekiekeleavcqdvlslldnylikncsetqyeskv
    fylkmkgdyyrylaevatgekratvvessekayseaheiskehmqpthpirlglalnysv
    fyyeiqnapeqachlaktafddaiaeldtlnedsykdstlimqllrdnltlwtsdqqddd
    ggegnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b05B (B:)
    vdreqlvqkarlaeqaeryddmaaamknvtelneplsneernllsvayknvvgarrsswr
    vissieqktsadgnekkiemvrayrekiekeleavcqdvlslldnylikncsetqyeskv
    fylkmkgdyyrylaevatgekratvvessekayseaheiskehmqpthpirlglalnysv
    fyyeiqnapeqachlaktafddaiaeldtlnedsykdstlimqllrdnltlwt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2b05C (C:)
    vdreqlvqkarlaeqaeryddmaaamknvtelneplsneernllsvayknvvgarrsswr
    vissieqktsadgnekkiemvrayrekiekeleavcqdvlslldnylikncsetqyeskv
    fylkmkgdyyrylaevatgekratvvessekayseaheiskehmqpthpirlglalnysv
    fyyeiqnapeqachlaktafddaiaeldtlnedsykdstlimqllrdnltlwtsdqqddd
    ggegnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b05C (C:)
    vdreqlvqkarlaeqaeryddmaaamknvtelneplsneernllsvayknvvgarrsswr
    vissieqktsadgnekkiemvrayrekiekeleavcqdvlslldnylikncsetqyeskv
    fylkmkgdyyrylaevatgekratvvessekayseaheiskehmqpthpirlglalnysv
    fyyeiqnapeqachlaktafddaiaeldtlnedsykdstlimqllrdnltlwt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2b05D (D:)
    vdreqlvqkarlaeqaeryddmaaamknvtelneplsneernllsvayknvvgarrsswr
    vissieqktsadgnekkiemvrayrekiekeleavcqdvlslldnylikncsetqyeskv
    fylkmkgdyyrylaevatgekratvvessekayseaheiskehmqpthpirlglalnysv
    fyyeiqnapeqachlaktafddaiaeldtlnedsykdstlimqllrdnltlwtsdqqddd
    ggegnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b05D (D:)
    vdreqlvqkarlaeqaeryddmaaamknvtelneplsneernllsvayknvvgarrsswr
    vissieqktsadgnekkiemvrayrekiekeleavcqdvlslldnylikncsetqyeskv
    fylkmkgdyyrylaevatgekratvvessekayseaheiskehmqpthpirlglalnysv
    fyyeiqnapeqachlaktafddaiaeldtlnedsykdstlimqllrdnltlwt
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2b05E (E:)
    vdreqlvqkarlaeqaeryddmaaamknvtelneplsneernllsvayknvvgarrsswr
    vissieqktsadgnekkiemvrayrekiekeleavcqdvlslldnylikncsetqyeskv
    fylkmkgdyyrylaevatgekratvvessekayseaheiskehmqpthpirlglalnysv
    fyyeiqnapeqachlaktafddaiaeldtlnedsykdstlimqllrdnltlwtsdqqddd
    ggegnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b05E (E:)
    reqlvqkarlaeqaeryddmaaamknvtelneplsneernllsvayknvvgarrsswrvi
    ssieqktsadgnekkiemvrayrekiekeleavcqdvlslldnylikncsetqyeskvfy
    lkmkgdyyrylaevatgekratvvessekayseaheiskehmqpthpirlglalnysvfy
    yeiqnapeqachlaktafddaiaeldtlnedsykdstlimqllrdnltlwt
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2b05F (F:)
    vdreqlvqkarlaeqaeryddmaaamknvtelneplsneernllsvayknvvgarrsswr
    vissieqktsadgnekkiemvrayrekiekeleavcqdvlslldnylikncsetqyeskv
    fylkmkgdyyrylaevatgekratvvessekayseaheiskehmqpthpirlglalnysv
    fyyeiqnapeqachlaktafddaiaeldtlnedsykdstlimqllrdnltlwtsdqqddd
    ggegnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b05F (F:)
    dreqlvqkarlaeqaeryddmaaamknvtelneplsneernllsvayknvvgarrsswrv
    issieqktsadgnekkiemvrayrekiekeleavcqdvlslldnylikncsetqyeskvf
    ylkmkgdyyrylaevatgekratvvessekayseaheiskehmqpthpirlglalnysvf
    yyeiqnapeqachlaktafddaiaeldtlnedsykdstlimqllrdnltlwt
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.