PDB entry 2b04

View 2b04 on RCSB PDB site
Description: Crystal Structure of Porcine Pancreatic Phospholipase A2 in Complex with Glycochenodeoxycholate
Class: hydrolase
Keywords: Bile salt, binding, glycochenodeoxycholate, carboxylic ester hydrolase, pancreatic enzyme
Deposited on 2005-09-12, released 2006-11-14
The last revision prior to the SCOP 1.73 freeze date was dated 2007-05-22, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.211
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase a2, major isoenzyme
    Species: SUS SCROFA
    Gene: PLA2G1B
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2b04a1
  • Heterogens: CHO, CA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2b04A (A:)
    alwqfrsmikcaipgshplmdfnnygcycglggsgtpvdeldrccethdncyrdaknlds
    ckflvdnpytesysyscsnteitcnsknnaceaficncdrnaaicfskapynkehknldt
    kkyc
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b04A (A:)
    alwqfrsmikcaipgfnnygcycglggsgtpvdeldrccethdncyrdaknldsckflvd
    npytesysyscsnteitcnsknnaceaficncdrnaaicfskapynkehknldtkkyc