PDB entry 2azy

View 2azy on RCSB PDB site
Description: Crystal Structure of Porcine Pancreatic Phospholipase A2 in Complex with Cholate
Class: hydrolase
Keywords: Bile salt, binding, cholate, CARBOXYLIC ESTER HYDROLASE, PLA2, Pancreatic Enzyme
Deposited on 2005-09-12, released 2006-11-14
The last revision prior to the SCOP 1.75 freeze date was dated 2007-05-22, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.167
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: phospholipase a2, major isoenzyme
  Species: SUS SCROFA
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00592 (0-123)
  Domains in SCOP 1.75: d2azya1
• Heterogens: CA, CHD, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2azyA (A:)
  alwqfrsmikcaipgshplmdfnnygcycglggsgtpvdeldrccethdncyrdaknlds
  ckflvdnpytesysyscsnteitcnsknnaceaficncdrnaaicfskapynkehknldt
  kkyc