PDB entry 2azb

View 2azb on RCSB PDB site
Description: HIV-1 Protease NL4-3 3X mutant in complex with inhibitor, TL-3
Class: hydrolase/hydrolase inhibitor
Keywords: HIV-1, protease, inhibitor, TL-3, HYDROLASE-HYDROLASE INHIBITOR COMPLEX
Deposited on 2005-09-09, released 2006-02-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protease retropepsin
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03367 (0-98)
      • variant (6)
      • variant (36)
      • engineered (45)
      • engineered (81)
    Domains in SCOPe 2.07: d2azba_
  • Heterogens: 3TL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2azbA (A:)
    pqitlwkrplvtikiggqlkealldtgaddtvleemnlpgrwkpkiiggigglikvrqyd
    qilieicghkaigtvlvgptpaniigrnlltqigctlnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2azbA (A:)
    pqitlwkrplvtikiggqlkealldtgaddtvleemnlpgrwkpkiiggigikvrqydqi
    lieicghkaigtvlvgptpaniigrnlltqigctlnf