PDB entry 2ayh

View 2ayh on RCSB PDB site
Description: crystal and molecular structure at 1.6 angstroms resolution of the hybrid bacillus endo-1,3-1,4-beta-d-glucan 4-glucanohydrolase h(a16-m)
Class: hydrolase (glucanase)
Keywords: hydrolase (glucanase)
Deposited on 1995-02-02, released 1995-03-31
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.143
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 1,3-1,4-beta-d-glucan 4-glucanohydrolase
    Species: hybrid [TaxId:37965]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2ayha_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ayhA (A:)
    qtggsffepfnsynsgtwekadgysnggvfnctwrannvnftndgklklgltssaynkfd
    caeyrstniygyglyevsmkpakntgivssfftytgpahgtqwdeidieflgkdttkvqf
    nyytngvgghekvislgfdaskgfhtyafdwqpgyikwyvdgvlkhtatanipstpgkim
    mnlwngtgvddwlgsynganplyaeydwvkytsn