PDB entry 2axt

View 2axt on RCSB PDB site
Description: Crystal Structure of Photosystem II from Thermosynechococcus elongatus
Class: electron transport
Keywords: photosystem, ps ii, ps2, membrane complex, transmembrane alpha-helix, ELECTRON TRANSPORT
Deposited on 2005-09-06, released 2005-12-27
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.234
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Photosystem Q(B) protein
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2axta1
  • Chain 'B':
    Compound: CP47 protein
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
    • GB BAB19261
    Domains in SCOPe 2.01: d2axtb1
  • Chain 'C':
    Compound: Photosystem II CP43 protein
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
    • GB BAC09183
    Domains in SCOPe 2.01: d2axtc1
  • Chain 'D':
    Compound: Photosystem II reaction center D2 protein
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
    • GB BAC09182
    Domains in SCOPe 2.01: d2axtd1
  • Chain 'E':
    Compound: cytochrome b559 alpha subunit
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2axte1
  • Chain 'F':
    Compound: cytochrome b559 beta subunit
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2axtf1
  • Chain 'H':
    Compound: Photosystem II reaction center H protein
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2axth1
  • Chain 'I':
    Compound: Photosystem II reaction center I protein
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2axti1
  • Chain 'J':
    Compound: Photosystem II reaction center J protein
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2axtj1
  • Chain 'K':
    Compound: Photosystem II reaction center protein K
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2axtk1
  • Chain 'L':
    Compound: Photosystem II reaction center L protein
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2axtl1
  • Chain 'M':
    Compound: Photosystem II reaction center M protein
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2axtm1
  • Chain 'O':
    Compound: Photosystem II manganese-stabilizing polypeptide
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2axto1
  • Chain 'T':
    Compound: Photosystem II reaction center T protein
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2axtt1
  • Chain 'U':
    Compound: Photosystem II 12 kDa extrinsic protein
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2axtu1
  • Chain 'V':
    Compound: cytochrome c-550
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2axtv1
  • Chain 'X':
    Compound: unassigned subunits
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed):
    • PDB 2AXT
  • Chain 'Z':
    Compound: Photosystem II reaction center Z protein
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2axtz1
  • Chain 'a':
    Compound: Photosystem Q(B) protein
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed):
  • Chain 'b':
    Compound: CP47 protein
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
    • GB BAB19261
  • Chain 'c':
    Compound: Photosystem II CP43 protein
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
    • GB BAC09183 (Start-472)
  • Chain 'd':
    Compound: Photosystem II reaction center D2 protein
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
    • GB BAC09182 (Start-351)
  • Chain 'e':
    Compound: cytochrome b559 alpha subunit
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed):
  • Chain 'f':
    Compound: cytochrome b559 beta subunit
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed):
  • Chain 'h':
    Compound: Photosystem II reaction center H protein
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed):
  • Chain 'i':
    Compound: Photosystem II reaction center I protein
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed):
  • Chain 'j':
    Compound: Photosystem II reaction center J protein
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed):
  • Chain 'k':
    Compound: Photosystem II reaction center protein K
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed):
  • Chain 'l':
    Compound: Photosystem II reaction center L protein
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed):
  • Chain 'm':
    Compound: Photosystem II reaction center M protein
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed):
  • Chain 'o':
    Compound: Photosystem II manganese-stabilizing polypeptide
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed):
  • Chain 't':
    Compound: Photosystem II reaction center T protein
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed):
  • Chain 'u':
    Compound: Photosystem II 12 kDa extrinsic protein
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed):
  • Chain 'v':
    Compound: cytochrome c-550
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed):
  • Chain 'x':
    Compound: unassigned subunits
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed):
    • PDB 2AXT (0-128)
  • Chain 'z':
    Compound: Photosystem II reaction center Z protein
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CA, FE2, BCT, UNK, CLA, PHO, HEM, PQ9, OEC, BCR, MGE, DGD, LHG, SQD, LMT

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2axtA (A:)
    mtttlqrresanlwerfcnwvtstdnrlyvgwfgvimiptllaaticfviafiaappvdi
    dgirepvsgsllygnniitgavvpssnaiglhfypiweaasldewlynggpyqliifhfl
    lgascymgrqwelsyrlgmrpwicvaysaplasafavfliypigqgsfsdgmplgisgtf
    nfmivfqaehnilmhpfhqlgvagvfggalfcamhgslvtsslirettetesanygykfg
    qeeetynivaahgyfgrlifqyasfnnsrslhfflaawpvvgvwftalgistmafnlngf
    nfnhsvidakgnvintwadiinranlgmevmhernahnfpldla
    

    Sequence, based on observed residues (ATOM records): (download)
    >2axtA (A:)
    sanlwerfcnwvtstdnrlyvgwfgvimiptllaaticfviafiaappvdidgirepvsg
    sllygnniitgavvpssnaiglhfypiweaasldewlynggpyqliifhfllgascymgr
    qwelsyrlgmrpwicvaysaplasafavfliypigqgsfsdgmplgisgtfnfmivfqae
    hnilmhpfhqlgvagvfggalfcamhgslvtsslirettetesanygykfgqeeetyniv
    aahgyfgrlifqyasfnnsrslhfflaawpvvgvwftalgistmafnlngfnfnhsvida
    kgnvintwadiinranlgmevmhernahnfpldla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2axtB (B:)
    mglpwyrvhtvlindpgrliaahlmhtalvagwagsmalyelatfdpsdpvlnpmwrqgm
    fvlpfmarlgvtgswsgwsitgetgidpgfwsfegvalahivlsgllflaacwhwvywdl
    elfrdprtgepaldlpkmfgihlflagllcfgfgafhltglfgpgmwvsdpygltgsvqp
    vapewgpdgfnpynpggvvahhiaagivgiiaglfhilvrppqrlykalrmgnietvlss
    siaavffaafvvagtmwygsattpielfgptryqwdssyfqqeinrrvqaslasgatlee
    awsaipeklafydyignnpakgglfrtgpmnkgdgiaqawkghavfrnkegeelfvrrmp
    affesfpviltdkngvvkadipfrraeskysfeqqgvtvsfyggelngqtftdpptvksy
    arkaifgeifefdtetlnsdgifrtsprgwftfahavfallfffghiwhgartlfrdvfs
    gidpelspeqvewgfyqkvgdvttrrkeav
    

    Sequence, based on observed residues (ATOM records): (download)
    >2axtB (B:)
    glpwyrvhtvlindpgrliaahlmhtalvagwagsmalyelatfdpsdpvlnpmwrqgmf
    vlpfmarlgvtgswsgwsitgetgidpgfwsfegvalahivlsgllflaacwhwvywdle
    lfrdprtgepaldlpkmfgihlflagllcfgfgafhltglfgpgmwvsdpygltgsvqpv
    apewgpdgfnpynpggvvahhiaagivgiiaglfhilvrppqrlykalrmgnietvlsss
    iaavffaafvvagtmwygsattpielfgptryqwdssyfqqeinrrvqaslasgatleea
    wsaipeklafydyignnpakgglfrtgpmnkgdgiaqawkghavfrnkegeelfvrrmpa
    ffesfpviltdkngvvkadipfrraeskysfeqqgvtvsfyggelngqtftdpptvksya
    rkaifgeifefdtetlnsdgifrtsprgwftfahavfallfffghiwhgartlfrdvfsg
    idpelspe
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2axtC (C:)
    mktlssqkryspvvtlssnsifatnrdqessgfawwagnarlinlsgkllgahvahagli
    vfwagamtlfelahfipekpmyeqgliliphiatlgwgvgpggevvdtfpffvvgvvhli
    ssavlgfggvyhairgpetleeyssffgydwkdknkmttilgfhlivlgigalllvakam
    ffgglydtwapgggdvrvitnptldprvifgyllkspfggegwivsvnnledvvgghiwi
    gliciaggiwhilttpfgwarrafiwsgeaylsyslgalsmmgfiatcfvwfnntvypse
    fygptgpeasqaqamtflirdqklganvgsaqgptglgkylmrsptgeiifggetmrfwd
    frgpwleplrgpngldlnkikndiqpwqerraaeymthaplgslnsvggvateinsvnfv
    sprswlatshfvlaffflvghlwhagraraaaagfekgidresepvlsmpsld
    

    Sequence, based on observed residues (ATOM records): (download)
    >2axtC (C:)
    dqessgfawwagnarlinlsgkllgahvahaglivfwagamtlfelahfipekpmyeqgl
    iliphiatlgwgvgpggevvdtfpffvvgvvhlissavlgfggvyhairgpetleeyssf
    fgydwkdknkmttilgfhlivlgigalllvakamffgglydtwapgggdvrvitnptldp
    rvifgyllkspfggegwivsvnnledvvgghiwigliciaggiwhilttpfgwarrafiw
    sgeaylsyslgalsmmgfiatcfvwfnntvypsefygptgpeasqaqamtflirdqklga
    nvgsaqgptglgkylmrsptgeiifggetmrfwdfrgpwleplrgpngldlnkikndiqp
    wqerraaeymthaplgslnsvggvateinsvnfvsprswlatshfvlaffflvghlwhag
    raraaaagfekgidresepvlsmpsld
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2axtD (D:)
    mtiaigrapaergwfdilddwlkrdrfvfvgwsgillfpcaylalggwltgttfvtswyt
    hglassylegcnfltvavstpansmghsllllwgpeaqgdftrwcqlgglwtfialhgaf
    gligfmlrqfeiarlvgvrpynaiafsapiavfvsvfliyplgqsswffapsfgvaaifr
    fllffqgfhnwtlnpfhmmgvagvlggallcaihgatventlfqdgegastfrafnptqa
    eetysmvtanrfwsqifgiafsnkrwlhffmlfvpvtglwmsaigvvglalnlrsydfis
    qeiraaedpefetfytknlllnegirawmapqdqphenfvfpeevlprgnal
    

    Sequence, based on observed residues (ATOM records): (download)
    >2axtD (D:)
    gwfdilddwlkrdrfvfvgwsgillfpcaylalggwltgttfvtswythglassylegcn
    fltvavstpansmghsllllwgpeaqgdftrwcqlgglwtfialhgafgligfmlrqfei
    arlvgvrpynaiafsapiavfvsvfliyplgqsswffapsfgvaaifrfllffqgfhnwt
    lnpfhmmgvagvlggallcaihgatventlfqdgegastfrafnptqaeetysmvtanrf
    wsqifgiafsnkrwlhffmlfvpvtglwmsaigvvglalnlrsydfisqeiraaedpefe
    tfytknlllnegirawmapqdqphenfvfpeevlprgnal
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2axtE (E:)
    magttgerpfsdiitsvrywvihsitipalfiagwlfvstglaydvfgtprpdsyyaqeq
    rsiplvtdrfeakqqvetfleqlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2axtE (E:)
    gttgerpfsdiitsvrywvihsitipalfiagwlfvstglaydvfgtprpdsyyaqeqrs
    iplvtdrfeakqqvetfleqlk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2axtF (F:)
    mtsntpnqepvsypiftvrwvavhtlavptifflgaiaamqfiqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2axtF (F:)
    vsypiftvrwvavhtlavptifflgaiaamqfiqr
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2axtH (H:)
    marrtwlgdilrplnseygkvapgwgttplmavfmglflvflliileiynstlildgvnv
    swkalg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2axtH (H:)
    arrtwlgdilrplnseygkvapgwgttplmavfmglflvflliileiynstlildgvnvs
    wkal
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2axtI (I:)
    metlkitvyivvtffvllfvfgflsgdparnpkrkdle
    

    Sequence, based on observed residues (ATOM records): (download)
    >2axtI (I:)
    metlkitvyivvtffvllfvfgflsgdparnpkrk
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2axtJ (J:)
    mmseggriplwivatvagmgvivivglffygayaglgssl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2axtJ (J:)
    riplwivatvagmgvivivglffygayaglgssl
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2axtK (K:)
    klpeayaifdplvdvlpvipvlflalafvwqaavgfr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2axtL (L:)
    mepnpnrqpvelnrtslylglllilvlallfssyffn
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2axtM (M:)
    mevnqlgliatalfvlvpsvfliilyvqtesqqkss
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >2axtO (O:)
    aakqtltyddivgtglankcptlddtargaypidssqtyriarlclqpttflvkeepknk
    rqeaefvptklvtrettsldqiqgelkvnsdgsltfveedgidfqpvtvqmaggeripll
    ftvknlvastqpnvtsittstdfkgefnvpsyrtanfldpkgrglasgydsaialpqake
    eelaranvkrfsltkgqislnvakvdgrtgeiagtfeseqlsdddmgahephevkiqgvf
    yasiepa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2axtO (O:)
    tltyddivgtglankcptlddtargaypidssqtyriarlclqpttflvkeepknkrqea
    efvptklvtrettsldqiqgelkvnsdgsltfveedgidfqpvtvqmaggeripllftvk
    nlvastqpnvtsittstdfkgefnvpsyrtanfldpkgrglasgydsaialpqakeeela
    ranvkrfsltkgqislnvakvdgrtgeiagtfeseqlsdddmgahephevkiqgvfyasi
    ep
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >2axtT (T:)
    metityvfifaciialfffaiffreppritkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2axtT (T:)
    metityvfifaciialfffaiffrepprit
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >2axtU (U:)
    atasteeelvnvvdeklgtaygekidlnntniaafiqyrglyptlaklivknapyesved
    vlnipglterqkqilrenlehftvtevetalveggdrynnglyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2axtU (U:)
    eelvnvvdeklgtaygekidlnntniaafiqyrglyptlaklivknapyesvedvlnipg
    lterqkqilrenlehftvtevetalveggdrynnglyk
    

  • Chain 'V':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2axtV (V:)
    aeltpevltvplnsegktitltekqylegkrlfqyacaschvggitktnpsldlrtetla
    latpprdnieglvdymknpttydgeqeiaevhpslrsadifpkmrnltekdlvaiaghil
    vepkilgdkwgggkvyy
    

  • Chain 'X':
    No sequence available.

  • Chain 'Z':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2axtZ (Z:)
    mtilfqlalaalvilsfvmvigvpvayaspqdwdrskqliflgsglwialvlvvgvlnff
    vv
    

  • Chain 'a':
    No sequence available.

  • Chain 'b':
    No sequence available.

  • Chain 'c':
    No sequence available.

  • Chain 'd':
    No sequence available.

  • Chain 'e':
    No sequence available.

  • Chain 'f':
    No sequence available.

  • Chain 'h':
    No sequence available.

  • Chain 'i':
    No sequence available.

  • Chain 'j':
    No sequence available.

  • Chain 'k':
    No sequence available.

  • Chain 'l':
    No sequence available.

  • Chain 'm':
    No sequence available.

  • Chain 'o':
    No sequence available.

  • Chain 't':
    No sequence available.

  • Chain 'u':
    No sequence available.

  • Chain 'v':
    No sequence available.

  • Chain 'x':
    No sequence available.

  • Chain 'z':
    No sequence available.