PDB entry 2axj

View 2axj on RCSB PDB site
Description: Crystal structures of T cell receptor beta chains related to rheumatoid arthritis
Class: immune system
Keywords: TCR, Immune System
Deposited on 2005-09-05, released 2005-09-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SF4 T cell receptor beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2axja1, d2axja2
  • Chain 'B':
    Compound: SF4 T cell receptor beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2axjb1, d2axjb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2axjA (A:)
    dggitqspkylfrkegqnvtlsceqnlnhdamywyrqdpgqglrliyysqivndfqkgdi
    aegysvsrekkesfpltvtsaqknptafylcasrdrgteklffgsgtqlsvledlnkvfp
    pevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpqplkeqpa
    lndsryclssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgr
    ad
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2axjB (B:)
    dggitqspkylfrkegqnvtlsceqnlnhdamywyrqdpgqglrliyysqivndfqkgdi
    aegysvsrekkesfpltvtsaqknptafylcasrdrgteklffgsgtqlsvledlnkvfp
    pevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpqplkeqpa
    lndsryclssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgr
    ad