PDB entry 2axa

View 2axa on RCSB PDB site
Description: Crystal Structure Of The Androgen Receptor Ligand Binding Domain In Complex With S-1
Class: transcription
Keywords: transcription
Deposited on 2005-09-03, released 2005-09-20
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.21
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Androgen receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: Ar
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2axaa_
  • Heterogens: FHM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2axaA (A:)
    iegyecqpiflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalp
    gfrnlhvddqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmysq
    cvrmrhlsqefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriia
    ckrknptscsrrfyqltklldsvqpiarelhqftfdllikshmvsvdfpemmaeiisvqv
    pkilsgkvkpiyfhtq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2axaA (A:)
    iflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalpgfrnlhvd
    dqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmysqcvrmrhls
    qefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriiacsrrfyql
    tklldsvqpiarelhqftfdllikshmvsvdfpemmaeiisvqvpkilsgkvkpiyfh