PDB entry 2ax4

View 2ax4 on RCSB PDB site
Description: Crystal structure of the kinase domain of human 3'-phosphoadenosine 5'-phosphosulphate synthetase 2
Class: transferase
Keywords: PAPSS2, Structural Genomics, Structural Genomics Consortium, SGC, TRANSFERASE
Deposited on 2005-09-02, released 2005-09-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.215
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthethase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: PAPSS2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ax4a_
  • Chain 'B':
    Compound: Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthethase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: PAPSS2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ax4b_
  • Chain 'C':
    Compound: Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthethase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: PAPSS2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ax4c_
  • Chain 'D':
    Compound: Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthethase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: PAPSS2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ax4d_
  • Heterogens: ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ax4A (A:)
    qahhvsrnkrgqvvgtrggfrgctvwltglsgagkttisfaleeylvshaipcysldgdn
    vrhglnrnlgfspgdreenirriaevaklfadaglvcitsfispfakdrenarkihesag
    lpffeifvdaplnicesrdvkglykrarageikgftgidsdyekpetpervlktnlstvs
    dcvhqvvellqeqnivpy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ax4B (B:)
    qahhvsrnkrgqvvgtrggfrgctvwltglsgagkttisfaleeylvshaipcysldgdn
    vrhglnrnlgfspgdreenirriaevaklfadaglvcitsfispfakdrenarkihesag
    lpffeifvdaplnicesrdvkglykrarageikgftgidsdyekpetpervlktnlstvs
    dcvhqvvellqeqnivpy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ax4B (B:)
    hvsrnkrgqvvgtrggfrgctvwltglsgagkttisfaleeylvshaipcysldgdnvrh
    glnrnlgfspgdreenirriaevaklfadaglvcitsfispfakdrenarkihesaglpf
    feifvdaplnicesrdvkglykrarageikgftgidsdyekpetpervlktnlstvsdcv
    hqvvellqeqnivpy
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ax4C (C:)
    qahhvsrnkrgqvvgtrggfrgctvwltglsgagkttisfaleeylvshaipcysldgdn
    vrhglnrnlgfspgdreenirriaevaklfadaglvcitsfispfakdrenarkihesag
    lpffeifvdaplnicesrdvkglykrarageikgftgidsdyekpetpervlktnlstvs
    dcvhqvvellqeqnivpy
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ax4D (D:)
    qahhvsrnkrgqvvgtrggfrgctvwltglsgagkttisfaleeylvshaipcysldgdn
    vrhglnrnlgfspgdreenirriaevaklfadaglvcitsfispfakdrenarkihesag
    lpffeifvdaplnicesrdvkglykrarageikgftgidsdyekpetpervlktnlstvs
    dcvhqvvellqeqnivpy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ax4D (D:)
    hvsrnkrgqvvgtrggfrgctvwltglsgagkttisfaleeylvshaipcysldgdnvrh
    glnrnlgfspgdreenirriaevaklfadaglvcitsfispfakdrenarkihesaglpf
    feifvdaplnicesrdvkglykrarageikgftgidsdyekpetpervlktnlstvsdcv
    hqvvellqeqnivpy