PDB entry 2awt

View 2awt on RCSB PDB site
Description: Solution Structure of Human Small Ubiquitin-Like Modifier Protein Isoform 2 (SUMO-2)
Class: protein transport
Keywords: ubiquitin fold, half-open barrel, two helices
Deposited on 2005-09-02, released 2006-10-24
The last revision prior to the SCOP 1.75 freeze date was dated 2006-10-24, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Small ubiquitin-related modifier 2
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2awta1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2awtA (A:)
    madekpkegvktenndhinlkvagqdgsvvqfkikrhtplsklmkaycerqglsmrqirf
    rfdgqpinetdtpaqlemededtidvfqqqtggvy