PDB entry 2awp

View 2awp on RCSB PDB site
Description: Crystal structure of Plasmodium knowlesi structure of Iron Super-Oxide Dismutase
Class: oxidoreductase
Keywords: Iron Super-Oxide Dismutase, Structural Genomics, Structural Genomics Consortium, SGC, OXIDOREDUCTASE
Deposited on 2005-09-01, released 2005-09-13
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.161
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Iron Super-Oxide Dismutase
    Species: Plasmodium knowlesi [TaxId:5850]
    Database cross-references and differences (RAF-indexed):
    • PDB 2AWP (0-End)
    Domains in SCOPe 2.04: d2awpa1, d2awpa2
  • Chain 'B':
    Compound: Iron Super-Oxide Dismutase
    Species: Plasmodium knowlesi [TaxId:5850]
    Database cross-references and differences (RAF-indexed):
    • PDB 2AWP
    Domains in SCOPe 2.04: d2awpb1, d2awpb2
  • Heterogens: CL, UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2awpA (A:)
    maiilpklkyalnalsphiseetlnfhynkhhagyvnklnglikdtpfatkslveimkes
    tgaifnnaaqiwnhsfywdsmgpncggephgeikekiqedfgsfnnfknefsnvlcghfg
    sgwgwlvlnnnnklvilqthdagnpikdntgipiltcdiwehayyidyrndrpsyvkaww
    nlvnwnfanenlkkalqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2awpA (A:)
    maiilpklkyalnalsphiseetlnfhynkhhagyvnklnglikdtpfatkslveimkes
    tgaifnnaaqiwnhsfywdsmgpncggephgeikekiqedfgsfnnfknefsnvlcghfg
    sgwgwlvlnnnnklvilqthdagnpikdntgipiltcdiwehayyidyrndrpsyvkaww
    nlvnwnfanenlkkalq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2awpB (B:)
    maiilpklkyalnalsphiseetlnfhynkhhagyvnklnglikdtpfatkslveimkes
    tgaifnnaaqiwnhsfywdsmgpncggephgeikekiqedfgsfnnfknefsnvlcghfg
    sgwgwlvlnnnnklvilqthdagnpikdntgipiltcdiwehayyidyrndrpsyvkaww
    nlvnwnfanenlkkalqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2awpB (B:)
    aiilpklkyalnalsphiseetlnfhynkhhagyvnklnglikdtpfatkslveimkest
    gaifnnaaqiwnhsfywdsmgpncggephgeikekiqedfgsfnnfknefsnvlcghfgs
    gwgwlvlnnnnklvilqthdagnpikdntgipiltcdiwehayyidyrndrpsyvkawwn
    lvnwnfanenlkkal