PDB entry 2aw7

View 2aw7 on RCSB PDB site
Description: Crystal structure of the bacterial ribosome from Escherichia coli at 3.5 A resolution. This file contains the 30S subunit of the second 70S ribosome. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
Class: ribosome
Keywords: RNA-protein complex, 30S RIBOSOMAL SUBUNIT
Deposited on 2005-08-31, released 2005-11-08
The last revision prior to the SCOP 1.73 freeze date was dated 2005-11-08, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 3.46 Å
R-factor: 0.279
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: 16S ribosomal RNA
  Species: Escherichia coli
  
• Chain 'B':
  Compound: 30S ribosomal protein S2
  Species: Escherichia coli
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A7V0
• Chain 'C':
  Compound: 30S ribosomal protein S3
  Species: Escherichia coli
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A7V3 (0-End)
• Chain 'D':
  Compound: 30S ribosomal protein S4
  Species: Escherichia coli
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A7V8 (0-204)
• Chain 'E':
  Compound: 30S ribosomal protein S5
  Species: Escherichia coli
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A7W1
• Chain 'F':
  Compound: 30S ribosomal protein S6
  Species: Escherichia coli
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02358 (0-End)
• Chain 'G':
  Compound: 30S ribosomal protein S7
  Species: Escherichia coli
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02359
• Chain 'H':
  Compound: 30S ribosomal protein S8
  Species: Escherichia coli
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A7W7 (0-128)
  Domains in SCOP 1.73: d2aw7h1
• Chain 'I':
  Compound: 30S ribosomal protein S9
  Species: Escherichia coli
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A7X3 (Start-128)
• Chain 'J':
  Compound: 30S ribosomal protein S10
  Species: Escherichia coli
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A7R5
• Chain 'K':
  Compound: 30S ribosomal protein S11
  Species: Escherichia coli
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A7R9 (Start-127)
• Chain 'L':
  Compound: 30S ribosomal protein S12
  Species: Escherichia coli
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A7S3 (0-122)
• Chain 'M':
  Compound: 30S ribosomal protein S13
  Species: Escherichia coli
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A7S9 (0-End)
• Chain 'N':
  Compound: 30S ribosomal protein S14
  Species: Escherichia coli
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02370 (0-99)
• Chain 'O':
  Compound: 30S ribosomal protein S15
  Species: Escherichia coli
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02371 (Start-88)
• Chain 'P':
  Compound: 30S ribosomal protein S16
  Species: Escherichia coli
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A7T3 (0-End)
• Chain 'Q':
  Compound: 30S ribosomal protein S17
  Species: Escherichia coli
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02373 (Start-82)
• Chain 'R':
  Compound: 30S ribosomal protein S18
  Species: Escherichia coli
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A7T7
• Chain 'S':
  Compound: 30S ribosomal protein S19
  Species: Escherichia coli
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A7U3 (0-End)
• Chain 'T':
  Compound: 30S ribosomal protein S20
  Species: Escherichia coli
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A7U7 (Start-85)
• Chain 'U':
  Compound: 30S ribosomal protein S21
  Species: Escherichia coli
  Database cross-references and differences (RAF-indexed):
  • Uniprot P68679
• Heterogens: MG, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  No sequence available.
  
  
• Chain 'G':
  No sequence available.
  
  
• Chain 'H':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2aw7H (H:)
  smqdpiadmltrirngqaankaavtmpssklkvaianvlkeegfiedfkvegdtkpelel
  tlkyfqgkavvesiqrvsrpglriykrkdelpkvmaglgiavvstskgvmtdraarqagl
  ggeiicyva
  

  
  
• Chain 'I':
  No sequence available.
  
  
• Chain 'J':
  No sequence available.
  
  
• Chain 'K':
  No sequence available.
  
  
• Chain 'L':
  No sequence available.
  
  
• Chain 'M':
  No sequence available.
  
  
• Chain 'N':
  No sequence available.
  
  
• Chain 'O':
  No sequence available.
  
  
• Chain 'P':
  No sequence available.
  
  
• Chain 'Q':
  No sequence available.
  
  
• Chain 'R':
  No sequence available.
  
  
• Chain 'S':
  No sequence available.
  
  
• Chain 'T':
  No sequence available.
  
  
• Chain 'U':
  No sequence available.