PDB entry 2avw

View 2avw on RCSB PDB site
Description: Crystal structure of monoclinic form of streptococcus Mac-1
Class: hydrolase
Keywords: Mac-1, HYDROLASE
Deposited on 2005-08-30, released 2006-02-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.218
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: IgG-degrading protease
    Species: Streptococcus pyogenes [TaxId:293653]
    Gene: mac
    Database cross-references and differences (RAF-indexed):
    • GB YP_282031
      • engineered (65)
    Domains in SCOPe 2.06: d2avwa_
  • Chain 'B':
    Compound: IgG-degrading protease
    Species: Streptococcus pyogenes [TaxId:293653]
    Gene: mac
    Database cross-references and differences (RAF-indexed):
    • GB YP_282031
      • engineered (65)
    Domains in SCOPe 2.06: d2avwb_
  • Chain 'C':
    Compound: IgG-degrading protease
    Species: Streptococcus pyogenes [TaxId:293653]
    Gene: mac
    Database cross-references and differences (RAF-indexed):
    • GB YP_282031
      • engineered (65)
    Domains in SCOPe 2.06: d2avwc_
  • Chain 'D':
    Compound: IgG-degrading protease
    Species: Streptococcus pyogenes [TaxId:293653]
    Gene: mac
    Database cross-references and differences (RAF-indexed):
    • GB YP_282031
      • engineered (65)
    Domains in SCOPe 2.06: d2avwd_
  • Chain 'E':
    Compound: IgG-degrading protease
    Species: Streptococcus pyogenes [TaxId:293653]
    Gene: mac
    Database cross-references and differences (RAF-indexed):
    • GB YP_282031
      • engineered (65)
    Domains in SCOPe 2.06: d2avwe_
  • Chain 'F':
    Compound: IgG-degrading protease
    Species: Streptococcus pyogenes [TaxId:293653]
    Gene: mac
    Database cross-references and differences (RAF-indexed):
    • GB YP_282031
      • engineered (65)
    Domains in SCOPe 2.06: d2avwf_
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2avwA (A:)
    mdsfsanqeirysevtpyhvtsvwtkgvtppanftqgedvfhapyvanqgwyditktfng
    kddllagaatagnmlhwwfdqnkdqikryleehpekqkinfngeqmfdvkeaidtknhql
    dsklfeyfkekafpylstkhlgvfpdhvidmfingyrlsltnhgptpvkegskdprggif
    davftrgdqsklltsrhdfkeknlkeisdlikkeltegkalglshtyanvrinhvinlwg
    adfdsngnlkaiyvtdsdsnasigmkkyfvgvnsagkvaisakeikednigaqvlglftl
    stgqdswnqtn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2avwA (A:)
    vtsvwtkgvtppanftqgedvfhapyvanqgwyditktfngkddllagaatagnmlhwwf
    dqnkdqikryleehpekqkinfngeqmfdvkeaidtknhqldsklfeyfkekafpylstk
    hlgvfpdhvidmfingyrlsltnhgptpvkegskdprggifdavftrgdqsklltsrhdf
    keknlkeisdlikkeltegkalglshtyanvrinhvinlwgadfdsngnlkaiyvtdsds
    nasigmkkyfvgvnsagkvaisakeikednigaqvlglftlstgqdswnq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2avwB (B:)
    mdsfsanqeirysevtpyhvtsvwtkgvtppanftqgedvfhapyvanqgwyditktfng
    kddllagaatagnmlhwwfdqnkdqikryleehpekqkinfngeqmfdvkeaidtknhql
    dsklfeyfkekafpylstkhlgvfpdhvidmfingyrlsltnhgptpvkegskdprggif
    davftrgdqsklltsrhdfkeknlkeisdlikkeltegkalglshtyanvrinhvinlwg
    adfdsngnlkaiyvtdsdsnasigmkkyfvgvnsagkvaisakeikednigaqvlglftl
    stgqdswnqtn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2avwB (B:)
    vtsvwtkgvtppanftqgedvfhapyvanqgwyditktfngkddllagaatagnmlhwwf
    dqnkdqikryleehpekqkinfngeqmfdvkeaidtknhqldsklfeyfkekafpylstk
    hlgvfpdhvidmfingyrlsltnhgptpvkegskdprggifdavftrgdqsklltsrhdf
    keknlkeisdlikkeltegkalglshtyanvrinhvinlwgadfdsngnlkaiyvtdsds
    nasigmkkyfvgvnsagkvaisakeikednigaqvlglftlstgqdswn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2avwC (C:)
    mdsfsanqeirysevtpyhvtsvwtkgvtppanftqgedvfhapyvanqgwyditktfng
    kddllagaatagnmlhwwfdqnkdqikryleehpekqkinfngeqmfdvkeaidtknhql
    dsklfeyfkekafpylstkhlgvfpdhvidmfingyrlsltnhgptpvkegskdprggif
    davftrgdqsklltsrhdfkeknlkeisdlikkeltegkalglshtyanvrinhvinlwg
    adfdsngnlkaiyvtdsdsnasigmkkyfvgvnsagkvaisakeikednigaqvlglftl
    stgqdswnqtn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2avwC (C:)
    vtsvwtkgvtppanftqgedvfhapyvanqgwyditktfngkddllagaatagnmlhwwf
    dqnkdqikryleehpekqkinfngeqmfdvkeaidtknhqldsklfeyfkekafpylstk
    hlgvfpdhvidmfingyrlsltnhgptpvkegskdprggifdavftrgdqsklltsrhdf
    keknlkeisdlikkeltegkalglshtyanvrinhvinlwgadfdsngnlkaiyvtdsds
    nasigmkkyfvgvnsagkvaisakeikednigaqvlglftlstgqdswn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2avwD (D:)
    mdsfsanqeirysevtpyhvtsvwtkgvtppanftqgedvfhapyvanqgwyditktfng
    kddllagaatagnmlhwwfdqnkdqikryleehpekqkinfngeqmfdvkeaidtknhql
    dsklfeyfkekafpylstkhlgvfpdhvidmfingyrlsltnhgptpvkegskdprggif
    davftrgdqsklltsrhdfkeknlkeisdlikkeltegkalglshtyanvrinhvinlwg
    adfdsngnlkaiyvtdsdsnasigmkkyfvgvnsagkvaisakeikednigaqvlglftl
    stgqdswnqtn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2avwD (D:)
    evtpyvtsvwtkgvtppanftqgedvfhapyvanqgwyditktfngkddllagaatagnm
    lhwwfdqnkdqikryleehpekqkinfngeqmfdvkeaidtknhqldsklfeyfkekafp
    ylstkhlgvfpdhvidmfingyrlsltnhgptpvkegskdprggifdavftrgdqskllt
    srhdfkeknlkeisdlikkeltegkalglshtyanvrinhvinlwgadfdsngnlkaiyv
    tdsdsnasigmkkyfvgvnsagkvaisakeikednigaqvlglftlstgqdswnqt
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2avwE (E:)
    mdsfsanqeirysevtpyhvtsvwtkgvtppanftqgedvfhapyvanqgwyditktfng
    kddllagaatagnmlhwwfdqnkdqikryleehpekqkinfngeqmfdvkeaidtknhql
    dsklfeyfkekafpylstkhlgvfpdhvidmfingyrlsltnhgptpvkegskdprggif
    davftrgdqsklltsrhdfkeknlkeisdlikkeltegkalglshtyanvrinhvinlwg
    adfdsngnlkaiyvtdsdsnasigmkkyfvgvnsagkvaisakeikednigaqvlglftl
    stgqdswnqtn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2avwE (E:)
    evtpyvtsvwtkgvtppanftqgedvfhapyvanqgwyditktfngkddllagaatagnm
    lhwwfdqnkdqikryleehpekqkinfngeqmfdvkeaidtknhqldsklfeyfkekafp
    ylstkhlgvfpdhvidmfingyrlsltnhgptpvkegskdprggifdavftrgdqskllt
    srhdfkeknlkeisdlikkeltegkalglshtyanvrinhvinlwgadfdsngnlkaiyv
    tdsdsnasigmkkyfvgvnsagkvaisakeikednigaqvlglftlstgqdswnqt
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2avwF (F:)
    mdsfsanqeirysevtpyhvtsvwtkgvtppanftqgedvfhapyvanqgwyditktfng
    kddllagaatagnmlhwwfdqnkdqikryleehpekqkinfngeqmfdvkeaidtknhql
    dsklfeyfkekafpylstkhlgvfpdhvidmfingyrlsltnhgptpvkegskdprggif
    davftrgdqsklltsrhdfkeknlkeisdlikkeltegkalglshtyanvrinhvinlwg
    adfdsngnlkaiyvtdsdsnasigmkkyfvgvnsagkvaisakeikednigaqvlglftl
    stgqdswnqtn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2avwF (F:)
    vtsvwtkgvtppanftqgedvfhapyvanqgwyditktfngkddllagaatagnmlhwwf
    dqnkdqikryleehpekqkinfngeqmfdvkeaidtknhqldsklfeyfkekafpylstk
    hlgvfpdhvidmfingyrlsltnhgptpvkegskdprggifdavftrgdqsklltsrhdf
    keknlkeisdlikkeltegkalglshtyanvrinhvinlwgadfdsngnlkaiyvtdsds
    nasigmkkyfvgvnsagkvaisakeikednigaqvlglftlstgqdswn