PDB entry 2aus

View 2aus on RCSB PDB site
Description: Crystal structure of the archaeal box H/ACA sRNP Nop10-Cbf5 complex
Class: isomerase/structural protein
Keywords: isomerase, structural protein, isomerase-structural protein complex
Deposited on 2005-08-29, released 2006-07-11
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.224
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pseudouridine synthase
    Species: Pyrococcus abyssi [TaxId:29292]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Ribosome biogenesis protein Nop10
    Species: Pyrococcus abyssi [TaxId:29292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2ausb_
  • Chain 'C':
    Compound: pseudouridine synthase
    Species: Pyrococcus abyssi [TaxId:29292]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Ribosome biogenesis protein Nop10
    Species: Pyrococcus abyssi [TaxId:29292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2ausd_
  • Heterogens: ZN, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ausB (B:)
    mrfrirkcpkcgrytlketcpvcgektkvahpprfspedpygeyrrrlkrellgigrkek
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ausB (B:)
    rirkcpkcgrytlketcpvcgektkvahpprfspedpygeyrrrlkrellgig
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ausD (D:)
    mrfrirkcpkcgrytlketcpvcgektkvahpprfspedpygeyrrrlkrellgigrkek
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ausD (D:)
    rirkcpkcgrytlketcpvcgektkvahpprfspedpygeyrrrlkrellgig