PDB entry 2au1

View 2au1 on RCSB PDB site
Description: Crystal Structure of group A Streptococcus MAC-1 orthorhombic form
Class: hydrolase
Keywords: mac-1, hydrolase
Deposited on 2005-08-26, released 2006-02-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.216
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: IgG-degrading protease
    Species: Streptococcus pyogenes [TaxId:293653]
    Database cross-references and differences (RAF-indexed):
    • GB AAZ51286 (0-291)
    Domains in SCOPe 2.06: d2au1a_
  • Heterogens: BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2au1A (A:)
    vtsvwtkgvtppanftqgedvfhapyvanqgwyditktfngkddllcgaatagnmlhwwf
    dqnkdqikryleehpekqkinfngeqmfdvkeaidtknhqldsklfeyfkekafpylstk
    hlgvfpdhvidmfingyrlsltnhgptpvkegskdprggifdavftrgdqsklltsrhdf
    keknlkeisdlikkeltegkalglshtyanvrinhvinlwgadfdsngnlkaiyvtdsds
    nasigmkkyfvgvnsagkvaisakeikednigaqvlglftlstgqdswnqtn