PDB entry 2atf

View 2atf on RCSB PDB site
Description: X-RAY STRUCTURE OF cysteine dioxygenase type I FROM MUS MUSCULUS MM.241056
Class: oxidoreductase
Keywords: Mm.241056, pfam05995.2 CDO_I, BC013638, CUPIN FAMILY, STRUCTURAL GENOMICS, PROTEIN STRUCTURE INITIATIVE, PSI, Center for Eukaryotic Structural Genomics, CESG
Deposited on 2005-08-24, released 2005-10-18
The last revision prior to the SCOP 1.75 freeze date was dated 2007-02-13, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.181
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cysteine dioxygenase type I
    Species: MUS MUSCULUS
    Gene: Cdo1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60334
      • modified residue (72)
      • modified residue (116)
      • modified residue (178)
    Domains in SCOP 1.75: d2atfa1
  • Heterogens: NI, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2atfA (A:)
    sertellkprtladlirilhelfagdevnveevqavleayesnpaewalyakfdqyrytr
    nlvdqgngkfnlmilcwgeghgssihdhtdshcflkllqgnlketlfdwpdkksnemikk
    sertlrenqcayindsiglhrvenvshtepavslhlysppfdtchafdqrtghknkvtmt
    fhskfgirtpfttsgslenn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2atfA (A:)
    ellkprtladlirilhelfagdevnveevqavleayesnpaewalyakfdqyrytrnlvd
    qgngkfnlmilcwgeghgssihdhtdshcflkllqgnlketlfdwpdkksnemikksert
    lrenqcayindsiglhrvenvshtepavslhlysppfdtchafdqrtghknkvtmtfhsk
    fgirtp