PDB entry 2at9

View 2at9 on RCSB PDB site
Description: structure of bacteriorhodopsin at 3.0 angstrom by electron crystallography
Deposited on 1998-12-17, released 1999-04-27
The last revision prior to the SCOP 1.61 freeze date was dated 1999-04-27, with a file datestamp of 1999-04-26.
Experiment type: EDIF
Resolution: 3 Å
R-factor: 0.237
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.61: d2at9__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2at9_ (-)
grpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsmllgyg
ltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigtglvg
altkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvvlwsay
pvvwligsegagivplnietllfmvldvsakvgfglillrsr