PDB entry 2at3

View 2at3 on RCSB PDB site
Description: 1.00 A Crystal Structure Of L123V/L133V Mutant of Nitrophorin 4 From Rhodnius Prolixus Complexed With Imidazole at pH 5.6
Class: transport protein
Keywords: Lipocalin, beta barrel, ferric heme, imidazole, TRANSPORT PROTEIN
Deposited on 2005-08-24, released 2006-08-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1 Å
R-factor: 0.145
AEROSPACI score: 1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: Nitrophorin 4
    Species: Rhodnius prolixus [TaxId:13249]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q94734 (0-183)
      • engineered (122)
      • engineered (132)
    Domains in SCOPe 2.08: d2at3x_
  • Heterogens: HEM, IMD, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2at3X (X:)
actknaiaqtgfnkdkyfngdvwyvtdyldlepddvpkrycaalaagtasgklkealyhy
dpktqdtfydvselqveslgkytanfkkvdkngnvkvavtagnyytftvmyaddssalih
tcvhkgnkdlgdvyavlnrnkdaaagdkvksavsaatlefskfistkenncaydndslks
lltk