PDB entry 2asx

View 2asx on RCSB PDB site
Description: The solution structure of the hamp domain of the hypothetical transmembrane receptor Af1503
Class: unknown function
Keywords: homodimer, parallel coiled-coil, complementary x-da packing
Deposited on 2005-08-24, released 2006-08-29
The last revision prior to the SCOP 1.75 freeze date was dated 2007-08-14, with a file datestamp of 2007-08-10.
Experiment type: NMR22
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hypothetical protein AF1503
  Species: Archaeoglobus fulgidus
  Gene: Af1503
  Database cross-references and differences (RAF-indexed):
  • Uniprot O28769 (2-55)
    • cloning artifact (0-1)
  Domains in SCOP 1.75: d2asxa1
• Chain 'B':
  Compound: hypothetical protein AF1503
  Species: Archaeoglobus fulgidus
  Gene: Af1503
  Database cross-references and differences (RAF-indexed):
  • Uniprot O28769 (2-55)
    • cloning artifact (0-1)
  Domains in SCOP 1.75: d2asxb1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2asxA (A:)
  gsstitrpiielsntadkiaegnleaevphqnradeigilaksierlrrslkvame
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2asxB (B:)
  gsstitrpiielsntadkiaegnleaevphqnradeigilaksierlrrslkvame