PDB entry 2asq

View 2asq on RCSB PDB site
Description: Solution Structure of SUMO-1 in Complex with a SUMO-binding Motif (SBM)
Class: protein binding
Keywords: Protein-Peptide Complex, SUMO-1, Small Ubiquitin-like Modifier 1, SUMO-Binding Motif, SBM, Protein Inhibitor of Activated STAT, PIASx, PROTEIN BINDING
Deposited on 2005-08-23, released 2005-10-11
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Small ubiquitin-related modifier 1
  Species: Homo sapiens [TaxId:9606]
  Gene: SUMO1, SMT3C, SMT3H3, UBL1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P63165 (Start-96)
  Domains in SCOPe 2.03: d2asqa1
• Chain 'B':
  Compound: Protein inhibitor of activated STAT2
  Species: Homo sapiens [TaxId:9606]
  Gene: PIAS2, PIASX
  Database cross-references and differences (RAF-indexed):
  • Uniprot O75928 (0-End)

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2asqA (A:)
  msdqeakpstedlgdkkegeyiklkvigqdsseihfkvkmtthlkklkesycqrqgvpmn
  slrflfegqriadnhtpkelgmeeedvievyqeqtgg
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2asqA (A:)
  yiklkvigqdsseihfkvkmtthlkklkesycqrqgvpmnslrflfegqriadnhtpkel
  gmeeedvievyqeqtgg
  

  
  
• Chain 'B':
  No sequence available.