PDB entry 2as5

View 2as5 on RCSB PDB site
Description: Structure of the DNA binding domains of NFAT and FOXP2 bound specifically to DNA.
Class: Transcription/DNA
Keywords: Forkhead Domain, RHR Domain, Rel Homology Region, IG Fold, Winged Helix-Turn-Helix, B-DNA, Transcription/DNA COMPLEX
Deposited on 2005-08-22, released 2006-08-08
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.238
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5'-d(tp*tp*ap*gp*gp*ap*ap*ap*ap*tp*tp*tp*gp*tp*tp*tp*cp*ap*tp*ap*gp*)-3'
    Species: synthetic, synthetic
  • Chain 'B':
    Compound: 5'-d(ap*ap*cp*tp*ap*tp*gp*ap*ap*ap*cp*ap*ap*ap*tp*tp*tp*tp*cp*cp*tp*)-3'
  • Chain 'C':
    Compound: 5'-d(tp*tp*ap*gp*gp*ap*ap*ap*ap*tp*tp*tp*gp*tp*tp*tp*cp*ap*tp*ap*gp*)-3'
    Species: synthetic, synthetic
  • Chain 'D':
    Compound: 5'-d(ap*ap*cp*tp*ap*tp*gp*ap*ap*ap*cp*ap*ap*ap*tp*tp*tp*tp*cp*cp*tp*)-3'
  • Chain 'F':
    Compound: Forkhead box protein P2
    Species: Homo sapiens [TaxId:9606]
    Gene: FOXP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15409 (0-End)
      • engineered (0)
    Domains in SCOPe 2.01: d2as5f_
  • Chain 'G':
    Compound: Forkhead box protein P2
    Species: Homo sapiens [TaxId:9606]
    Gene: FOXP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15409 (0-End)
      • engineered (0)
    Domains in SCOPe 2.01: d2as5g_
  • Chain 'M':
    Compound: Nuclear factor of activated T-cells, cytoplasmic 2
    Species: Homo sapiens [TaxId:9606]
    Gene: NFATC2, NFAT1, NFATP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2as5m1, d2as5m2
  • Chain 'N':
    Compound: Nuclear factor of activated T-cells, cytoplasmic 2
    Species: Homo sapiens [TaxId:9606]
    Gene: NFATC2, NFAT1, NFATP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2as5n1, d2as5n2
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2as5F (F:)
    ivrppftyatlirqaimessdrqltlneiyswftrtfayfrrnaatwknavrhnlslhkc
    fvrvenvkgavwtvdeveyqkrrsqkitgsptl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2as5F (F:)
    ivrppftyatlirqaimessdrqltlneiyswftrtfayfrrnaatwknavrhnlslhkc
    fvrvenvkgavwtvdeveyqkrr
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2as5G (G:)
    ivrppftyatlirqaimessdrqltlneiyswftrtfayfrrnaatwknavrhnlslhkc
    fvrvenvkgavwtvdeveyqkrrsqkitgsptl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2as5G (G:)
    ivrppftyatlirqaimessdrqltlneiyswftrtfayfrrnaatwknavrhnlslhkc
    fvrvenvkgavwtvdeveyqkrr
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2as5M (M:)
    aslpplewplssqsgsyelrievqpkphhrahyetegsrgavkaptgghpvvqlhgymen
    kplglqifigtaderilkphafyqvhritgktvtttsyekivgntkvleiplepknnmra
    tidcagilklrnadielrkgetdigrkntrvrlvfrvhipessgrivslqtasnpiecsq
    rsahelpmverqdtdsclvyggqqmiltgqnftseskvvftekttdgqqiwemeatvdkd
    ksqpnmlfveipeyrnkhirtpvkvnfyvingkrkrsqpqhftyhpv
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2as5N (N:)
    aslpplewplssqsgsyelrievqpkphhrahyetegsrgavkaptgghpvvqlhgymen
    kplglqifigtaderilkphafyqvhritgktvtttsyekivgntkvleiplepknnmra
    tidcagilklrnadielrkgetdigrkntrvrlvfrvhipessgrivslqtasnpiecsq
    rsahelpmverqdtdsclvyggqqmiltgqnftseskvvftekttdgqqiwemeatvdkd
    ksqpnmlfveipeyrnkhirtpvkvnfyvingkrkrsqpqhftyhpv