PDB entry 2ar7

View 2ar7 on RCSB PDB site
Description: Crystal structure of human adenylate kinase 4, AK4
Class: transferase
Keywords: AK4, nucleotide kinase, nucleotide binding, human, Structural Genomics, Structural Genomics Consortium, SGC, TRANSFERASE
Deposited on 2005-08-19, released 2005-12-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.169
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Adenylate kinase 4
    Species: Homo sapiens [TaxId:9606]
    Gene: AK3, AK4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27144 (Start-244)
      • cloning artifact (245)
    Domains in SCOPe 2.07: d2ar7a1, d2ar7a2, d2ar7a3
  • Chain 'B':
    Compound: Adenylate kinase 4
    Species: Homo sapiens [TaxId:9606]
    Gene: AK3, AK4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27144 (Start-244)
      • cloning artifact (245)
    Domains in SCOPe 2.07: d2ar7b1, d2ar7b2, d2ar7b3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ar7A (A:)
    mhhhhhhssgvdlgtenlyfqsmaskllravilgppgsgkgtvcqriaqnfglqhlssgh
    flrenikastevgemakqyieksllvpdhvitrlmmselenrrgqhwlldgfprtlgqae
    aldkicevdlvislnipfetlkdrlsrrwihppsgrvynldfnpphvhgiddvtgeplvq
    qeddkpeavaarlrqykdvakpvielyksrgvlhqfsgtetnkiwpyvytlfsnkitpiq
    skeayl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ar7A (A:)
    kllravilgppgsgkgtvcqriaqnfglqhlssghflrenikastevgemakqyieksll
    vpdhvitrlmmselenrrgqhwlldgfprtlgqaealdkicevdlvislnipfetlkdrl
    srrwihppsgrvynldfnpphvhgiddvtgeplvqqeddkpeavaarlrqykdvakpvie
    lyksrgvlhqfsgtetnkiwpyvytlfsnkitpiqskeayl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ar7B (B:)
    mhhhhhhssgvdlgtenlyfqsmaskllravilgppgsgkgtvcqriaqnfglqhlssgh
    flrenikastevgemakqyieksllvpdhvitrlmmselenrrgqhwlldgfprtlgqae
    aldkicevdlvislnipfetlkdrlsrrwihppsgrvynldfnpphvhgiddvtgeplvq
    qeddkpeavaarlrqykdvakpvielyksrgvlhqfsgtetnkiwpyvytlfsnkitpiq
    skeayl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ar7B (B:)
    kllravilgppgsgkgtvcqriaqnfglqhlssghflrenikastevgemakqyieksll
    vpdhvitrlmmselenrrgqhwlldgfprtlgqaealdkicevdlvislnipfetlkdrl
    srrwihppsgrvynldfnpphvhgiddvtgeplvqqeddkpeavaarlrqykdvakpvie
    lyksrgvlhqfsgtetnkiwpyvytlfsnkitpiqskeayl