PDB entry 2aqw

View 2aqw on RCSB PDB site
Description: Structure of putative orotidine-monophosphate-decarboxylase from Plasmodium yoelii (PY01515)
Class: structural genomics, unknown function
Keywords: decarboxylase PY01515 SGC, Structural Genomics, Structural Genomics Consortium, UNKNOWN FUNCTION
Deposited on 2005-08-18, released 2005-08-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative orotidine-monophosphate-decarboxylase
    Species: Plasmodium yoelii [TaxId:5861]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7RPE4
      • modified residue (32)
      • modified residue (47)
      • modified residue (105)
      • modified residue (131)
      • modified residue (136)
      • modified residue (139)
      • modified residue (170)
      • modified residue (174)
      • modified residue (219)
      • modified residue (226)
      • modified residue (251)
    Domains in SCOPe 2.07: d2aqwa1
  • Heterogens: IOD, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2aqwA (A:)
    mhfktklknrrsevntclcigldpdeddiknfmkneeqngykniknnmnsnnngieniik
    igkeilltdgeniqnlseedkffyffnhfcfyiinntkeyalvykmnfafyipygsvgin
    alknvfdylnsmniptmldmkindigntvknyrkfifeylksdsctinvymgtnmlkdic
    fdyeknkyysayvlikttnkdsfifqnelsindkqayivmadetqkmatelkieqnnefi
    gfvvgsnafeemkiirnkfpdsyilspgigaqngdlyktlkngynkdyekllinvgrait
    kspdpkkssesyynqiiqifkdiengdnieqv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aqwA (A:)
    hfktklknrrsevntclcigldpdeddiknfmkneeqngykniknnmnsnnngieniiki
    gkeilltdgeniqnlseedkffyffnhfcfyiinntkeyalvykmnfafyipygsvgina
    lknvfdylnsmniptmldmkindigntvknyrkfifeylksdsctinvymgtnmlkdicf
    dyeknkyysayvlikttnkdsfifqnelsindkqayivmadetqkmatelkieqnnefig
    fvvgsnafeemkiirnkfpdsyilspgigaqngdlyktlkngynkdyekllinvgraitk
    spdpkkssesyynqiiqifkd