PDB entry 2aqq

View 2aqq on RCSB PDB site
Description: CU/ZN superoxid dismutate from neisseria meningitidis K91E mutant
Class: oxidoreductase
Keywords: Cu/Zn Superoxide dismutase, electrostatic guidance, neisseria meningitidis, OXIDOREDUCTASE
Deposited on 2005-08-18, released 2006-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.172
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Neisseria meningitidis [TaxId:487]
    Gene: SODC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q59623 (Start-163)
      • engineered (68)
    Domains in SCOPe 2.07: d2aqqa_
  • Chain 'B':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Neisseria meningitidis [TaxId:487]
    Gene: SODC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q59623 (Start-163)
      • engineered (68)
    Domains in SCOPe 2.07: d2aqqb_
  • Chain 'C':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Neisseria meningitidis [TaxId:487]
    Gene: SODC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q59623 (Start-163)
      • engineered (68)
    Domains in SCOPe 2.07: d2aqqc_
  • Heterogens: CU1, CU, ZN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2aqqA (A:)
    hehntipkgasievkvqqldpvngnkdvgtvtitesnyglvftpdlqglseglhgfhihe
    npscepkeeegkltaglgagghwdpkgakqhgypwqddahlgdlpaltvlhdgtatnpvl
    aprlkhlddvrghsimihtggdnhsdhpaplggggprmacgvik
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aqqA (A:)
    asievkvqqldpvngnkdvgtvtitesnyglvftpdlqglseglhgfhihenpscepkee
    egkltaglgagghwdpkgakqhgypwqddahlgdlpaltvlhdgtatnpvlaprlkhldd
    vrghsimihtggdnhsdhpaplggggprmacgvik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2aqqB (B:)
    hehntipkgasievkvqqldpvngnkdvgtvtitesnyglvftpdlqglseglhgfhihe
    npscepkeeegkltaglgagghwdpkgakqhgypwqddahlgdlpaltvlhdgtatnpvl
    aprlkhlddvrghsimihtggdnhsdhpaplggggprmacgvik
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aqqB (B:)
    asievkvqqldpvngnkdvgtvtitesnyglvftpdlqglseglhgfhihenpscepkee
    egkltaglgagghwdpkgakqhgypwqddahlgdlpaltvlhdgtatnpvlaprlkhldd
    vrghsimihtggdnhsdhpaplggggprmacgvik
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2aqqC (C:)
    hehntipkgasievkvqqldpvngnkdvgtvtitesnyglvftpdlqglseglhgfhihe
    npscepkeeegkltaglgagghwdpkgakqhgypwqddahlgdlpaltvlhdgtatnpvl
    aprlkhlddvrghsimihtggdnhsdhpaplggggprmacgvik
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aqqC (C:)
    asievkvqqldpvngnkdvgtvtitesnyglvftpdlqglseglhgfhihenpscepkee
    egkltaglgagghwdpkgakqhgypwqddahlgdlpaltvlhdgtatnpvlaprlkhldd
    vrghsimihtggdnhsdhpaplggggprmacgvik