PDB entry 2aqn

View 2aqn on RCSB PDB site
Description: CU/ZN superoxide dismutase from neisseria meningitidis
Class: oxidoreductase
Keywords: superoxide dismutase, neisseria meningitidis., OXIDOREDUCTASE
Deposited on 2005-08-18, released 2006-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.128
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Neisseria meningitidis [TaxId:487]
    Gene: SODC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2aqna_
  • Chain 'B':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Neisseria meningitidis [TaxId:487]
    Gene: SODC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2aqnb_
  • Chain 'C':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Neisseria meningitidis [TaxId:487]
    Gene: SODC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2aqnc_
  • Heterogens: CU1, ZN, CU, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2aqnA (A:)
    hehntipkgasievkvqqldpvngnkdvgtvtitesnyglvftpdlqglseglhgfhihe
    npscepkekegkltaglgagghwdpkgakqhgypwqddahlgdlpaltvlhdgtatnpvl
    aprlkhlddvrghsimihtggdnhsdhpaplggggprmacgvik
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aqnA (A:)
    asievkvqqldpvngnkdvgtvtitesnyglvftpdlqglseglhgfhihenpscepkek
    egkltaglgagghwdpkgakqhgypwqddahlgdlpaltvlhdgtatnpvlaprlkhldd
    vrghsimihtggdnhsdhpaplggggprmacgvik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2aqnB (B:)
    hehntipkgasievkvqqldpvngnkdvgtvtitesnyglvftpdlqglseglhgfhihe
    npscepkekegkltaglgagghwdpkgakqhgypwqddahlgdlpaltvlhdgtatnpvl
    aprlkhlddvrghsimihtggdnhsdhpaplggggprmacgvik
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aqnB (B:)
    asievkvqqldpvngnkdvgtvtitesnyglvftpdlqglseglhgfhihenpscepkek
    egkltaglgagghwdpkgakqhgypwqddahlgdlpaltvlhdgtatnpvlaprlkhldd
    vrghsimihtggdnhsdhpaplggggprmacgvik
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2aqnC (C:)
    hehntipkgasievkvqqldpvngnkdvgtvtitesnyglvftpdlqglseglhgfhihe
    npscepkekegkltaglgagghwdpkgakqhgypwqddahlgdlpaltvlhdgtatnpvl
    aprlkhlddvrghsimihtggdnhsdhpaplggggprmacgvik
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aqnC (C:)
    asievkvqqldpvngnkdvgtvtitesnyglvftpdlqglseglhgfhihenpscepkek
    egkltaglgagghwdpkgakqhgypwqddahlgdlpaltvlhdgtatnpvlaprlkhldd
    vrghsimihtggdnhsdhpaplggggprmacgvik